KEGG   Paramecium tetraurelia: GSPATT00021701001Help
Entry
GSPATT00021701001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 323 aa AA seqDB search
MSTSLAKPKKLKLTDYEVFQTLGTGSFGRVKLARNKQTNKYVALKSLKKAEIIRLKQVDH
VINENTILGNLQHPFIVNFEGFCQDPRYLYLVLEFVSGGELFTYLRSIGRLDTQHAGFYA
SQVASMFEYLHSKNIIYRDLKPENLLIADDGYLKLTDFGFAKVVEGRTYTLCGTPEYLAP
EILLNKGHGKAVDWWTLGILIYEMNAGIDPFSDEDPMAIYQKILKGKVKFPKSFDKNAKS
LVKHLLVADLSKRYGNLKNGAADIKNHRWFGNLDWNLLLQKKLPVPYKPVVKAPNDTSNF
SSYPESDTQSPALKPADDPFLEW
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagtacatctctagcaaaacctaagaaactcaagttgacagattatgaagtatttcaa
acacttggcacaggttcttttgggcgagtcaaattagcaaggaacaaataaacaaataaa
tatgttgccttaaaaagtttaaagaaagcggaaattatacgtttaaagcaagttgatcat
gtgattaatgagaataccatattgggcaacttgcagcatccttttattgttaatttcgaa
ggattctgccaagatccgagatatctatatctagtattagaatttgtttctggaggtgaa
ttatttacttatttgagaagcataggaagacttgatacataacatgcaggtttttatgct
tcttaagtggcttcaatgtttgaatatcttcactccaaaaatattatatacagagattta
aaaccggaaaacttattaatagcagatgacggatacttaaaactgacagattttggattt
gctaaagtagttgaaggaagaacctatacactctgcggaacaccagaatatttggcacct
gagattttgttgaataaaggacatggtaaagcagtagattggtggacattgggcatattg
atatatgaaatgaatgcaggaattgatcccttttctgatgaagatcctatggctatttac
taaaaaattcttaaaggaaaggttaagtttccaaaatcttttgataaaaatgctaaatcc
ttagtcaaacatctcttagttgcagatttgtctaaaagatatggaaatctaaagaatggg
gctgctgatattaaaaatcatagatggtttggaaatcttgattggaatttgttattatag
aagaaattgccagttccttataagccagttgttaaagctcccaatgatacgtcgaatttc
tcgtcatatccagaatccgatacttaaagtccagcccttaaacctgcagatgatcccttc
cttgaatggtga

DBGET integrated database retrieval system