KEGG   Paramecium tetraurelia: GSPATT00022149001Help
Entry
GSPATT00022149001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 378 aa AA seqDB search
MTSQIFKDLQPDQEISCLIGDVGGTNVRLQLVKISLKLTYQKAPQLKPYTTYNTDLYPQF
QDYIVEYLKDVQKDNLPQFAIIGIAGPIKNNSTLMANTKWSQVDGNAIGQALNIKPFLLI
NDFQAVAYGILGLQQTDLIQLNPKNPNPKENSVKTVIGPGTGLGVARLIPSLKENHAWEY
NIWPCEGGHVGYSPSNDLEIEYLQYLRKRLGLGQIVAEKAMAGQAVPFIYTFLKGRLGLE
SQIEKDLDQALFEDKNDFKQFPSTQVFQYGVEKKDELCQKVVDFFLTSYGTVIGDLVCNT
MPYGGIYLFGNISIGVANYIINNPQVNFLQDYVKYRPHLAEIFDQIPIYVIKQASLGLEG
AYQAAYRLLEYNDYEKEI
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctcaaatatttaaggatctttagcccgattaagaaattagttgcttgataggt
gatgtgggaggaacaaatgttcgtctccaactcgtcaagatctctctcaagttgacatat
caaaaagctccttaacttaaaccatatacaacctataacacagatttgtatcctcaattc
caagactacattgttgaatacttgaaggatgtataaaaggataatcttccttaatttgcc
attataggcattgctgggccaatcaaaaataattccactttgatggctaacactaaatgg
tcttaagtagatggaaatgccattggacaagcactcaacattaaaccatttctcttaatt
aatgacttctaggcagtggcatatggaattttgggactttagcaaacagacttgatccaa
ttgaatccaaaaaatccaaatccaaaagaaaattcagtcaaaactgtaattggtcctgga
actggattgggtgtagcaagattaattccatctttgaaagagaatcatgcatgggaatac
aatatttggccttgtgaaggaggacacgtaggatattccccatccaacgatttagaaata
gaatatctttaatatttgagaaagagattaggtttgggttagatagttgcagaaaaagca
atggccggttaagctgttccatttatctatacctttttaaagggaagacttggattggag
tcttaaattgaaaaggatcttgattaagccttatttgaagataagaatgatttcaaataa
ttcccatcgacataagtattttaatatggtgttgagaagaaagatgaattatgctaaaaa
gttgtggatttcttcttaactagttatggaacagttatcggagatctagtttgcaatact
atgccttatggaggtatttatttgtttggcaatatctctattggagttgccaattacatc
atcaataatccataagtcaattttttataagactacgttaaatatagacctcatttagct
gagattttcgattagatacctatttatgtgatcaaataggcttccttaggattagaaggt
gcttattaggcagcatatagattgttagagtataatgactatgaaaaagaaatttga

DBGET integrated database retrieval system