KEGG   Paramecium tetraurelia: GSPATT00022149001Help
Entry
GSPATT00022149001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ptm  Paramecium tetraurelia
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSPATT00022149001
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSPATT00022149001
   00052 Galactose metabolism
    GSPATT00022149001
   00500 Starch and sucrose metabolism
    GSPATT00022149001
   00520 Amino sugar and nucleotide sugar metabolism
    GSPATT00022149001
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    GSPATT00022149001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GSPATT00022149001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 378 aa AA seqDB search
MTSQIFKDLQPDQEISCLIGDVGGTNVRLQLVKISLKLTYQKAPQLKPYTTYNTDLYPQF
QDYIVEYLKDVQKDNLPQFAIIGIAGPIKNNSTLMANTKWSQVDGNAIGQALNIKPFLLI
NDFQAVAYGILGLQQTDLIQLNPKNPNPKENSVKTVIGPGTGLGVARLIPSLKENHAWEY
NIWPCEGGHVGYSPSNDLEIEYLQYLRKRLGLGQIVAEKAMAGQAVPFIYTFLKGRLGLE
SQIEKDLDQALFEDKNDFKQFPSTQVFQYGVEKKDELCQKVVDFFLTSYGTVIGDLVCNT
MPYGGIYLFGNISIGVANYIINNPQVNFLQDYVKYRPHLAEIFDQIPIYVIKQASLGLEG
AYQAAYRLLEYNDYEKEI
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctcaaatatttaaggatctttagcccgattaagaaattagttgcttgataggt
gatgtgggaggaacaaatgttcgtctccaactcgtcaagatctctctcaagttgacatat
caaaaagctccttaacttaaaccatatacaacctataacacagatttgtatcctcaattc
caagactacattgttgaatacttgaaggatgtataaaaggataatcttccttaatttgcc
attataggcattgctgggccaatcaaaaataattccactttgatggctaacactaaatgg
tcttaagtagatggaaatgccattggacaagcactcaacattaaaccatttctcttaatt
aatgacttctaggcagtggcatatggaattttgggactttagcaaacagacttgatccaa
ttgaatccaaaaaatccaaatccaaaagaaaattcagtcaaaactgtaattggtcctgga
actggattgggtgtagcaagattaattccatctttgaaagagaatcatgcatgggaatac
aatatttggccttgtgaaggaggacacgtaggatattccccatccaacgatttagaaata
gaatatctttaatatttgagaaagagattaggtttgggttagatagttgcagaaaaagca
atggccggttaagctgttccatttatctatacctttttaaagggaagacttggattggag
tcttaaattgaaaaggatcttgattaagccttatttgaagataagaatgatttcaaataa
ttcccatcgacataagtattttaatatggtgttgagaagaaagatgaattatgctaaaaa
gttgtggatttcttcttaactagttatggaacagttatcggagatctagtttgcaatact
atgccttatggaggtatttatttgtttggcaatatctctattggagttgccaattacatc
atcaataatccataagtcaattttttataagactacgttaaatatagacctcatttagct
gagattttcgattagatacctatttatgtgatcaaataggcttccttaggattagaaggt
gcttattaggcagcatatagattgttagagtataatgactatgaaaaagaaatttga

DBGET integrated database retrieval system