KEGG   Paramecium tetraurelia: GSPATT00023395001Help
Entry
GSPATT00023395001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ptm  Paramecium tetraurelia
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ptm03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 208 aa AA seqDB search
MAHKLSQNWVFWYAPRGRKAIAGSDHYDVNLKEIGEFNTVEEFYTYYCFLGRPSEIEIDN
KIMLFRKDHRPMWEECLEGGTWIIHFKKRENELLNKKWEALLLACIGEEFDDDNVIGVVL
SIRERRNLLEIWLKDRKESEKLRIGEKLRVALEMDPNNLTFFFKEHSKSLNDKSTMKGAE
SYTFVKTPLETPQTEPKGQHPDLDQFKL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggctcataaactatcataaaattgggtattttggtatgctcctagaggcagaaaagct
attgcaggttcagatcattatgatgtaaatttgaaagaaattggggaattcaatacagtc
gaagagttttacacatattattgttttttaggcagacctagcgaaattgaaattgacaac
aaaataatgttgtttaggaaggatcacagaccaatgtgggaagagtgtttggaaggaggc
acatggattattcattttaaaaaaagagagaatgaattattgaataagaaatgggaagcc
ttattgttagcatgcattggcgaggaattcgatgatgacaatgtaattggtgtagttttg
tccatcagagagagaagaaatttgttggaaatatggttgaaagacagaaaagagagtgaa
aagttgaggattggagagaaattaagagtggctttggaaatggatccaaacaatcttaca
ttcttcttcaaagaacacagcaagagcttgaatgataaatcaactatgaaaggagctgaa
tcatacacttttgtaaaaactccacttgaaactccatagactgaaccaaaaggacaacac
ccagatcttgatcagtttaaattatga

DBGET integrated database retrieval system