KEGG   Paramecium tetraurelia: GSPATT00023586001Help
Entry
GSPATT00023586001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
ptm  Paramecium tetraurelia
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    GSPATT00023586001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 236 aa AA seqDB search
MSEDPNEKWKKILLNPYGKSKDDVQNEIRAMHKEQQMIDEAITREALLQTIKAKKTYRNL
TNPNTNADKSKQVPVDGDLKQGAKVFMRACASCHSLEIFTGKPYAADFSFQESSGPSLAQ
IYNKPAASQRVYEEYTMALLDSKIFWNSYNLFMWAKDPQAMCKGTKCLQRGELLESAEER
ADLVKFLKGFAKATSDLYRRSFTKYHGYEWQNYREQGLAKAREVAHQRQGYEPEKK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggatccaaatgagaaatggaagaaaattcttttgaatccttatggaaaaagc
aaagatgatgtacagaatgaaataagagccatgcataaagaatagcaaatgattgacgaa
gcaataaccagagaggctttgctataaacaataaaggctaaaaagacatatcgaaattta
acaaatcctaatactaatgctgataaatctaaataagtgccagtggatggtgatttgaaa
taaggagcaaaagtatttatgcgtgcatgtgcttcttgtcactctttggaaatattcaca
ggaaaaccatatgcagcagatttttcattttaagaatccagtggaccatctttggctcaa
atctacaataaaccagcagctagttagagagtatatgaagaatatacaatggccttgttg
gattctaaaatattttggaatagttataatctatttatgtgggctaaagatccgtaagca
atgtgcaaggggacaaaatgtttataaagaggagaactattggagagtgcagaagaaaga
gctgacttagtaaagtttttgaaagggtttgcaaaggctacttctgatttgtacagaagg
tcattcacaaaatatcatggatatgaatggcaaaattatagagaatagggactggccaaa
gcaagagaggttgctcattagagataaggatatgaaccagagaagaagtga

DBGET integrated database retrieval system