KEGG   Paramecium tetraurelia: GSPATT00023941001Help
Entry
GSPATT00023941001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    GSPATT00023941001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     GSPATT00023941001
Peptidases [BR:ptm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GSPATT00023941001
Membrane trafficking [BR:ptm04131]
 Endosome - Lysosome transport
  Others
   Others
    GSPATT00023941001
Ubiquitin system [BR:ptm04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    GSPATT00023941001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 zf-MIZ
Motif
Other DBs
NCBI-GeneID: 5044376
NCBI-ProteinID: XP_001458610
Genoscope: GSPATT00023941001
UniProt: A0E7E6
Position
undetermined
AA seq 503 aa AA seqDB search
MGICQTKPKVNEPQSKMKKMNTEQRLMPKPSRILDVNYKQIPNKFRRQATQKRVQQIQQF
DTDTQGLFGLTNLGNTCFLNSSIQALSNTQPLTDYFMSQLHIKEINPENPLSSQGNIVKS
FAQLIRLLWQKVDQYQYDDMKVLKPTQFISTVGNYNPIFAEGTQEDAHEFIAFLLDMIHE
DLNRIKKKPYVEQAKFTKFPTNEDADAEWKKYLSRNQSIIVDLFQGQMLDTLSCLTCKSS
RYCFEPFMYLSVPVLNRECELQECIEEFLKKETLKGDEGWNCTNCNQRRDSNKKIDLWSM
PNILIIHLKRFKFNSQFRAKIRSLVKYPLQNLSFENLVCTKQVEKPTYDLYAVINHSGTL
TSGHYTAYGKNRDDLHWYHFNDSLVTPVQQPESLNDAYLLFYFKNSVEEFKRQTLEGINV
SQKRKTIKNTIVIKQTMLNMHSQQSNSNLSDYKRNNNNNLAPSVSSQAQKKMLFRKQTKH
FQIVKASEQPSFQQESYVIQEEN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgggcatttgctaaactaaacccaaagtaaatgaaccttagtcaaaaatgaaaaaaatg
aatacagaataacggttgatgccaaagcctagtcgcattttggatgtcaattacaaatag
atcccaaacaaatttagaaggtaagctacacaaaaaagagtttaacaaatttagtaattc
gataccgatacacagggattgttcggattgacgaatttaggaaacacatgctttttaaat
tcttctatttaagccttatcaaatacataaccattaacagattacttcatgtcctaactc
catatcaaagagataaatcctgaaaatcctctatcttcctaaggaaatatagtcaaatcg
tttgcgtaactaattagactgctatggtagaaggtggattaatactaatatgatgatatg
aaggtattgaaaccgacataatttatatcaacagttggaaattataatcctatatttgct
gaaggaacttaagaagatgcacatgaattcattgcttttttattggacatgatacatgaa
gatttgaatagaattaaaaagaaaccttatgtggaataagccaagtttactaaatttcca
actaatgaggacgcagatgcagaatggaaaaaatacctatcacgaaactaatccatcata
gtagatttattttaaggtcaaatgctggatacattgtcatgtctgacttgcaagtcttcg
agatattgttttgaaccttttatgtatctgagtgtacctgtgttgaatagagaatgtgaa
ttgtaggaatgcatagaagaattcttgaagaaagagactctcaagggagacgaagggtgg
aattgtactaattgcaattaaaggagagacagtaataaaaagattgatttatggtcaatg
ccaaatattctgattattcacttaaagcgatttaaatttaattcttaattcagagccaag
atcaggtcattggtcaaatatccattatagaatttatcttttgaaaatcttgtatgcaca
aaacaagtagaaaaacccacctatgatctttatgcagtcattaatcatagtggcacattg
acatctggacattacacagcttatggcaagaacagagatgatttacattggtatcatttc
aatgattcgttggttacaccagttcaatagccagaaagtttaaatgatgcatacttattg
ttttattttaagaatagtgttgaggaattcaaaagacaaaccttggaaggaatcaacgtc
agtcaaaaaagaaagacaataaaaaatacaatagtaattaagcaaacaatgctcaatatg
cattcttaataatctaatagcaatctgtcagattacaaaagaaacaataacaacaattta
gcaccctctgtttcaagtcaagcttaaaaaaaaatgttgtttagaaaataaacaaagcat
tttcaaatcgttaaagcttcagaataaccatcattctaataagaatcatatgtaatctaa
gaagaaaactga

DBGET integrated database retrieval system