KEGG   Paramecium tetraurelia: GSPATT00024468001Help
Entry
GSPATT00024468001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
ptm  Paramecium tetraurelia
Pathway
ptm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    GSPATT00024468001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 5044919
NCBI-ProteinID: XP_001459134
Genoscope: GSPATT00024468001
UniProt: A0E8X0
Position
undetermined
AA seq 160 aa AA seqDB search
MSWRKPKVLHQESGNGYEIRGFTEPTFKRVPHCHNDDDIDVDIPNGDLEFGKKMYGQACA
GCHDLDSDLDQGPALRNSYLRRLGSNKKFSNYGWDLRARRLYWTRKLLWDFLQNPEKMFL
DTNMQFDGIQDPRTLGSIIDYMQYLTVYTHDHRGSKRPIF
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggagaaaaccaaaagtccttcattaagaaagtggaaatggctatgaaataaga
ggattcactgaaccaactttcaaaagagttcctcattgtcacaacgatgatgatattgat
gttgacattccaaatggggaccttgaatttggtaagaagatgtacggttaagcatgtgct
ggttgccacgatttagacagtgatcttgatcaaggaccagcattgagaaattcttatttg
agaagattaggatctaacaagaagttttctaattatggatgggatttgagagcaagaaga
ttatattggacaagaaaattattgtgggatttcttataaaatccagagaaaatgtttttg
gatactaacatgcaatttgatggaatccaagatccaagaactctaggcagtataatcgac
tacatgtaatatttaacagtgtatactcacgatcatagaggatcaaaaagacccatcttt
tga

DBGET integrated database retrieval system