KEGG   Paramecium tetraurelia: GSPATT00024733001Help
Entry
GSPATT00024733001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GSPATT00024733001
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     GSPATT00024733001
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     GSPATT00024733001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 611 aa AA seqDB search
MYNEDDTQNVTKIKSHLVIDMQNHHDIIKEKLSDQPRKVLILNTGGTISMFPSSSGYVTK
TGALKNFLQNNPFSCDMDYTYFKATDDFLITPITAFNRRIWFKVDELDKLLDSSNMNSDD
WVTIAERIEKAYKHYDSFIILHGTDTMAYTASALSFMFQNLSKTVILTGSQVPLSQPRND
GFTNFLNALTIAGHFTIPEVLICFQDKLLRGNRAQKVNSSSLDSFDSPKFIPLGYFGVNI
SIKWDIIMKNPNEENLQVNKKFCTNISLIRLNPLLNHVTLNEIFKNEKLKGVVIETYGAG
NMQTEEKFCNEIAQAAKRGIVIVNISQCHTSQVEMIYETGIIFENMGVISGGDMTSQAAF
TKLGYLLAQTDDVDKVKDEFQRNIRGELTESGGTAETEPFLMALSSAIKQQHSKIDLNKD
LVFPNILCQICVQKKKLSSMKLSKIEQEINYKAQDYDKRSILHVAAREGSLEIAELILRK
CPEIVNNVDRWKHSPMYEAVMAKNTQMIQLLLRFQGKLIAPIKELTQLLMLDVANGKGDM
LNLFYEAGERDFTQYKTEDNRTVAHLAVSVGNDAALQFLSNPGVIFDWQVQDKFGRIPKD
EKILQKRLLKR
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtataatgaagatgatacacaaaatgtaaccaaaataaaatcgcatttggtgattgat
atgcaaaaccatcatgatataattaaagagaaattgagcgactaacccagaaaagtgttg
attctcaatactggtggcaccatttccatgtttccttcgtcatctggatatgttaccaaa
acaggagcattgaaaaacttcttataaaacaacccattctcctgcgatatggattacacc
tattttaaggctactgatgattttctgatcactcctatcacagcctttaacagaagaatt
tggtttaaggtggatgaattagataaattgcttgattcctcaaacatgaattcagatgat
tgggtaaccatagcggaaaggatagaaaaagcatataaacattatgatagtttcattata
ttgcatggaacagatacaatggcctatactgcgagtgctttgtcttttatgttccaaaat
ctttcaaaaacagtgatattgacaggtagtcaagtgcccttgtcacaaccaagaaacgat
gggtttactaattttctgaatgctctcacaatagctggccattttacaatcccagaagtc
ttaatatgcttccaagataaattgctcagaggcaatagagcttagaaagtgaattcttcc
tctttggattcttttgattctcctaaattcatacctttgggatactttggagtgaatatt
agtattaaatgggatattatcatgaagaatccaaatgaagagaatttataagtgaacaag
aaattctgcacgaatatcagtttgattcgtctgaatcccttgttaaatcatgtcacttta
aatgagatatttaagaatgagaaattgaagggagttgttatagagacttatggagcaggc
aatatgcaaacagaagaaaagttctgtaatgaaattgcttaggcagccaaaagaggaatt
gtaatagtcaacatctctcaatgtcatacatcctaagtagaaatgatttatgagactggc
atcatctttgaaaacatgggagtaatcagcggaggagacatgacatcctaagcagccttt
actaaactcgggtatttattggcttagactgatgacgttgataaggtcaaggatgaattc
caaaggaatataagaggagagttgacagaatcaggtggaacagctgagactgaacccttt
ttgatggccttgtcatcagccattaaatagcagcactccaaaattgatctgaataaggac
ttagtgttcccaaatatcttgtgtcagatatgtgtacagaagaagaaattgtcatcaatg
aaattatcaaagattgaataggaaatcaattacaaggcataagactatgacaagagaagc
atattacatgtggctgcaagagaaggttcattggagattgctgagttaatcctgaggaaa
tgcccagaaatcgttaacaatgtggatagatggaaacatagtcctatgtatgaagctgtc
atggctaagaacactcaaatgatctaattgctcttgagattccaagggaaattgattgcc
ccgatcaaagagttgacttaactccttatgttagatgtggctaatggaaagggagatatg
cttaatctcttttatgaagctggagaaagggatttcactcaatataagacggaagataac
agaactgttgctcatttggctgtttctgtgggcaatgatgctgccttgcaattcctgtcg
aatcctggggtgatttttgattggtaagtgcaagacaagtttggtcgaatacccaaagat
gagaaaattttatagaaaagactattaaagagatga

DBGET integrated database retrieval system