KEGG   Paramecium tetraurelia: GSPATT00024948001Help
Entry
GSPATT00024948001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ptm  Paramecium tetraurelia
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    GSPATT00024948001
   03410 Base excision repair
    GSPATT00024948001
   03420 Nucleotide excision repair
    GSPATT00024948001
   03430 Mismatch repair
    GSPATT00024948001
Enzymes [BR:ptm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GSPATT00024948001
    6.5.1.6  DNA ligase (ATP or NAD+)
     GSPATT00024948001
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     GSPATT00024948001
DNA replication proteins [BR:ptm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    GSPATT00024948001
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     GSPATT00024948001
DNA repair and recombination proteins [BR:ptm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     GSPATT00024948001
   NER (nucleotide excision repair)
    Other NER factors
     GSPATT00024948001
   MMR (mismatch exicision repair)
    Other MMR factors
     GSPATT00024948001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 680 aa AA seqDB search
MQKTIASFFKSSKKGDDSNDQIKEQQFIEENLKKEKLMPEQKVCASKSKSHNMEIKGAVL
FIDMAELYEQVGEIKGQNSKDAIKELVAKLFIRIMKENREEFVPAYLFSILKLGPDYESW
ELGIGQGIIVKSISAVSGKSEKQVRELMNTLGDLGLAIEKSKSTQTSLNKFFVSQSVKEE
VKLTMIQVFNTLQQLQKQEGTGSSLEKERILTGLLRMAKPIEAKYIIRFIEKNLKIGAAE
KTMQAALARAFQLYHKGNVEGDYESIINQALCECPNYKKIIDTLFSIQSLKEVPELCHII
PGVPCKPMLAKPMKSIQMIFQRFENMKFTCEYKYDGLRGQIHFENGQVSIFSRNLENMTQ
TYPDIVNYVHTHYQHLDGFIIDSEIVAYDVANNRILPFQTLTSRAKKNVDQNQIEIQVCL
YIFDLLYLNKQSYLKETLEKRRQTLRETFKEEEGKLKFATSRDSENFEEIEEFLLNSIKM
GCEGLMIKTLEINSQYEPAKRSFNWLKLKKDYLDNGLSDTFDLVPIGACYGTGKRKGFYG
SYLLACYNEDMDQYETTCKIGTGFSDENLEKFFQFFQEYLIPHPLSEYKCDGVNMDVWFS
PVVVWEIKSADIQISPIYSACSTILQLNNKGVGLRFPRLIKVREDKKPNEATSSQFLYDV
YKQQAVVASNNTFEQDDDFY
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaacaattgcctcattcttcaaatcaagtaagaaaggagatgattcaaatgat
tagatcaaggaacaacaatttatcgaggaaaacctcaagaaggagaaactgatgcctgaa
taaaaggtgtgtgcctcaaaatccaaatcgcataatatggaaatcaagggtgctgttctt
ttcatcgatatggctgaattatacgaacaagttggagagataaaaggctaaaattcaaag
gatgccatcaaagaattagtagctaaattgttcatcagaatcatgaaagaaaatagggaa
gaatttgtgccggcatacttgtttagcattttgaagttgggacccgattatgagtcatgg
gaattggggattggacaaggaatcatcgtgaaatctatcagtgctgtgtctgggaagagt
gaaaaataagtgagagaactcatgaacacattgggagatttgggtttggccattgaaaaa
tcaaaatcaacatagacatccttaaataaattttttgtttctcaaagtgtcaaggaggaa
gttaaattaacaatgatctaagtattcaacactctccaacaattgcaaaaataagaaggc
acaggaagttcattggagaaggagagaattctgactggtctcttaaggatggctaaaccc
attgaggccaagtacatcatacgattcatagagaagaatctcaagatcggagcagctgaa
aagacaatgcaagctgctttggctagagcattctaattgtatcataagggaaatgtggag
ggtgattacgaaagcataataaattaagcattgtgtgagtgtccgaattacaagaagatt
attgacactctattcagcattcaaagtttgaaggaggttcctgaattatgtcacataatt
ccaggagtgccatgcaaaccaatgttggctaaaccaatgaaatctatatagatgatcttt
tagagattcgaaaatatgaaatttacatgtgaatataaatatgatgggttgagaggtcag
attcattttgaaaatgggcaagtgagcatcttttcaaggaatctagaaaacatgacacaa
acatacccagatattgtcaactatgttcacactcattattaacatttggatggttttatt
atcgattctgaaattgttgcctatgatgtggcaaacaatagaatcttaccatttcaaact
ctaacaagtagagctaaaaagaatgtggattagaatcaaattgaaattcaagtttgttta
tacatatttgatttgctgtatttgaataagcagagttatttgaaagagactttggagaag
agaagatagactttgagagaaacattcaaagaggaggaaggaaagttgaagtttgcaacc
tcaagagattcagaaaattttgaagaaattgaggaatttctattaaattcaatcaaaatg
ggatgcgaaggtttgatgatcaagactttagagatcaattcgtaatatgaaccagccaag
agatcatttaattggttgaaattaaaaaaggattatttagataatggattgtctgataca
ttcgatttagtacctattggtgcttgttatggtacaggaaaaaggaagggattttatgga
agttatttgttagcttgctacaatgaagatatggatcaatatgagactacttgtaagatt
ggtactggattcagcgatgaaaatttagaaaagttcttttaattctttcaagaatacttg
attccacatccattatcagaatacaaatgtgatggagtgaatatggatgtttggtttagt
cctgtggttgtgtgggagatcaagagtgctgacattcagatatcacctatctatagtgct
tgttccactatcttgtaattaaataacaaaggagtggggttgagatttcctagattgatt
aaagtgagggaggacaagaaacctaatgaagccactagttcgcaatttttatatgatgta
tataaataataggctgttgttgccagcaataatacttttgagcaggatgatgatttttat
tga

DBGET integrated database retrieval system