KEGG   Paramecium tetraurelia: GSPATT00025299001Help
Entry
GSPATT00025299001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
ptm  Paramecium tetraurelia
Brite
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSPATT00025299001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 124 aa AA seqDB search
MGPTKSPKAEAKKTVKTVKTKKSTDDKKKARRRQETFALYIYKVLRQVHPEIGVSRKAMN
IMNSFINDIFDRIALEASKLVRFNKRRTLSSREIQTAVKLLLPGELARHAISEGTKAVTK
YTSG
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgggaccaacaaaatcaccaaaagcagaagcaaagaaaacagttaagactgttaaaacc
aaaaaatccacagatgacaagaagaaggcaagaagaagataagaaacctttgctttatat
atctacaaagtcttgagataagttcacccagaaatcggtgtttccagaaaggctatgaac
atcatgaattcattcatcaacgatattttcgacagaattgctcttgaagccagcaaatta
gtcagattcaacaagagaagaaccctcagttcaagggaaatctaaactgccgtcaaattg
ttactcccaggagaattggccagacatgccatctcagaaggaaccaaagcagtgaccaaa
tatacaagtggatga

DBGET integrated database retrieval system