KEGG   Paramecium tetraurelia: GSPATT00025378001Help
Entry
GSPATT00025378001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
ptm  Paramecium tetraurelia
Brite
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSPATT00025378001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 125 aa AA seqDB search
MAPSKSPKADAAKKTVKTVKTKKGSDDKKKARRRQETFALYIYKVLRQVHPEIGVSRKAM
NIMNSFINDIFDRIALEASKLVRFNKRRTLSSREIQTAVKLLLPGELARHAISEGTKAVT
KYTSG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggcaccatcaaaatcaccaaaggctgacgcagctaaaaagacagtcaaaacagtcaag
acaaagaagggatcagatgataaaaaaaaggcaagaagacgataagagacattcgctctt
tatatttacaaggttttaagataagttcacccagaaattggtgtttcaagaaaagctatg
aacattatgaactcattcatcaatgatatctttgatagaattgctcttgaagccagcaaa
ttggttagattcaacaagagaagaacactcagttcaagggaaatctaaacagcagtcaag
ttgcttcttccaggagaattggccagacatgccatctcagaaggaacaaaagcagtcacc
aaatacaccagtggttga

DBGET integrated database retrieval system