KEGG   Paramecium tetraurelia: GSPATT00025568001Help
Entry
GSPATT00025568001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00010  Glycolysis / Gluconeogenesis
ptm00260  Glycine, serine and threonine metabolism
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
ptm01230  Biosynthesis of amino acids
Module
ptm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ptm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSPATT00025568001
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSPATT00025568001
Enzymes [BR:ptm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GSPATT00025568001
Membrane trafficking [BR:ptm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GSPATT00025568001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GSPATT00025568001
  Exosomal proteins of melanoma cells
   GSPATT00025568001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 5046014
NCBI-ProteinID: XP_001460229
Genoscope: GSPATT00025568001
UniProt: A0EC15
Position
undetermined
AA seq 258 aa AA seqDB search
MQTVFKNALAKYRVVFLRHGESQWNKENRFTGWHDVTLSQKGVEEAKAAGQLLKKEGFQF
HQVYTSVLTRAIQTYNYAAEEMGCHYLPVTKTWRLNERHYGALQGLNKSETAQKHGEDQV
KIWRRSYDIPPPPLDPTDARNPANDRRYADVPKDALPLTECLKDTVVRVIPYWHDHIAKD
ILAGKNVLVVAHGNSLRSIVKYLDNVSEKDILELNIPTSVPLVYEFDSNLKSLGSYYLGD
QEEIRKKMEAVAKQGAKK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacagtgttcaagaatgctttagccaaatatagagtagtttttctaagacatggt
gaatcctagtggaataaggaaaacagattcacaggatggcatgatgttacactctcataa
aaaggagttgaagaagccaaggctgctggataattattaaagaaagaaggattttaattc
cattaggtttacacatcagtgttgacaagagctatttaaacatataactatgcagctgaa
gaaatgggatgccactatttgcctgtcactaaaacttggagacttaatgaaagacattat
ggtgctttgtaaggcttaaataagagtgagacagcacaaaagcatggagaggattaagtc
aaaatctggagaagatcatatgatatcccacctcctcctttggatccaacagatgccaga
aatccagccaatgatagaagatacgctgatgtccctaaagatgctttaccacttactgaa
tgccttaaagataccgttgttagagttattccatattggcatgatcatattgctaaagat
atccttgctggtaagaatgttttagtggtcgctcatggtaattccttaagaagcattgtt
aagtacttagataatgtctctgagaaagatattcttgagttgaatattcctacaagtgtt
cctttggtttatgaattcgatagcaatttaaagtccttgggatcttattatttgggagac
caagaagaaattagaaaaaaaatggaagctgttgccaaatagggtgcaaagaaatga

DBGET integrated database retrieval system