KEGG   Paramecium tetraurelia: GSPATT00025614001Help
Entry
GSPATT00025614001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     GSPATT00025614001
Peptidases [BR:ptm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GSPATT00025614001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 1032 aa AA seqDB search
MQDDAQQSEMKSKSQNLVQEVTISQEFEMPINKTKRFVLIPPLSQIRFEDEKNRLQYSCH
AKDGSEFDIQIEFENKADNASIFVSCKPVSQQLDHSKIYKLSSSIQSKKTKKQKDIKIEP
KDNLLKLQLTQKVKEQQLCLQNEILIELAPKYNSRDEVGYTGIINNSATCYMNSVFQILF
HLGIFEKLVYSIKSDQYNQFPCTLQALFYNLRHSQIAISTQEIIKSFKWDKDQQALQQDV
QEFIMELLKAMCIKVPEIEKDINELFQGELENHIKNEKFDNSNSEQFMDISLNITNSLNE
SLELFIQSEQLDAYTHDVYGKQEAIKYHRFKKLPPILLINLKRYQFDGQGFTKIHDYFQY
DDEINFKQYLINQVDEIYQLYAVLVHRGEAINHGHYYCYIRPTQNSQEWFKFDDKIVTRA
TKQEVFQNNFGGQYTQADYDGDLDEIITKKKNNPETAYMLVYIKANLPDILVSPKVFPEW
ILKQEQLYNDTQFEQRHFIQTNIFTINHLNQNQCQQMKTGIIFHKSALNQSIDQNVIEEF
FDQYTTPLLIPKIITVQQIIDQLSEKINVDKKYLHLLMYKISHLKPNLESVIQMQPQKNL
SFYLANKIYLFGLMLLSTNFEDQILINNYFGVDKIKLDLMPQIGGGKNSKENKSIVDNKV
LVIIKTYSNKIIEFDQILLLDKGQPILDTINREYTNNNQIKIYYQNDNLEFRQQNSMFKN
TEYIQVYLDFQNELETDIEQINNLREVIIKVLNESQCTSQLFNKNDSTSALLDFLAQLED
CKQENIQIKYKDKKGNIQTLQQQMKIEELIQFDNNISYKQTIVPIGALKEQMSFQVDNQT
YIILKSMSFAEFMEQEQLSPTTHVPLLISKKDKKQAQVQLDLTQKISRYTYKHEIKFIKP
IVLGTDIYLICFLQSVDIVLLCNPIVCQVSQNNTIAEMVNRIIQDVSQAPIQYKSQSIQI
TEDFIYSSEDNKTRRLEQQIRVRINNQEIQQDTQMGIGSLMPELKQLTLVMTFLTIRDTK
VDKLRQKGVQIF
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgatgcccaataatcagaaatgaaaagtaaaagctagaatttagtataagaa
gtgaccataagttaagaatttgaaatgccaatcaataaaacaaagagatttgtattgatc
ccaccactttcctaaattagatttgaagatgagaaaaatagactgcaatatagttgtcat
gctaaggatgggagtgaatttgatatctagatagaatttgaaaataaggctgataatgca
agtatttttgttagctgtaaacctgttagccaataattggatcactcaaaaatttataaa
ttatcaagttcaatttagagcaaaaaaacaaaaaaataaaaagacatcaaaatagaacca
aaggacaatcttctaaaactctaactcactcaaaaagtcaaggaataacaattgtgtttg
cagaatgaaattcttatagaactagcaccaaaatacaatagtcgggatgaagtaggatat
acaggtataatcaataactcagctacctgttatatgaatagtgtattttagattctattt
catctgggtatatttgagaaactggtctattcaataaagtctgactagtacaattagttt
ccatgcacattacaagccctgttctacaatctaagacacagttagatagccatttcgaca
taagaaatcattaagtcattcaaatgggacaaagatcaataagctctttaataggatgtt
taagaattcatcatggaacttctcaaagctatgtgtataaaggtgcctgaaatagagaaa
gacattaatgaactatttcaaggagagttggagaatcacataaagaatgagaagtttgac
aattcaaattctgaatagtttatggacatctctttgaatatcaccaattctctgaatgaa
tctcttgagttgttcatctaatctgaataattggatgcttatactcatgatgtgtatggt
aaacaggaagcaatcaaatatcatagatttaagaaattgcctccaattttactcataaat
ttaaagagatatcaatttgatggacaaggatttacaaagattcatgattacttctaatat
gatgatgaaatcaatttcaaatagtacttaatcaattaagtagatgagatctattaactg
tacgctgttttagtacatagaggtgaagcaattaaccatggtcattattactgttatata
agacctacccaaaactcttaagaatggttcaaattcgatgataaaatagttaccagagct
actaaataagaagtattccagaataacttcggtggacagtatacccaagctgattatgat
ggagatttggatgaaatcatcactaaaaaaaagaataatcctgaaactgcttatatgttg
gtttatatcaaagcaaatttaccagatattctagtaagtccaaaggttttcccagagtgg
attctgaagtaagagcagttgtataatgacacccaatttgaataaagacacttcatttaa
acaaatatattcactatcaatcatttgaatcagaatcaatgttagcaaatgaaaacaggt
atcatttttcataaatctgccttaaattaatctattgattaaaatgtcattgaagaattc
tttgattaatatacaacacctttacttattcctaaaataataactgttcaatagatcatt
gatcaattaagtgaaaagataaatgtagataaaaaatatctacatttattaatgtataaa
atatcacatttgaaaccaaatttggaatcagttatttaaatgcaaccacaaaagaatctg
tcattctatttggctaataaaatctacttatttggattaatgttactttctactaatttc
gaagatcaaatactcattaacaattattttggagttgataaaatcaaattagatttaatg
cctcaaattggaggaggcaagaattctaaagaaaataaaagtatagtagacaacaaagta
ttagtcattattaagacctactctaataaaataattgaattcgattaaatattgctactt
gataagggataaccaattttagataccattaatagagaatacactaataataactaaatt
aaaatctattattaaaatgacaatttggaatttagatagcaaaattcaatgtttaaaaat
acggaatatatttaagtttatttggatttccagaatgaattggaaacagatatcgaataa
atcaacaatctaagagaagtcataatcaaagtactcaatgaatcctaatgcacttcttag
ttatttaataaaaatgattctacttctgctttattagatttccttgcttaattggaggat
tgtaaacaagaaaacatttagatcaaatataaggacaaaaaggggaacatctaaaccttg
taacaataaatgaaaatagaagaactgatctaatttgataataacattagttataaataa
acaatagtaccaataggagcattgaaagaacaaatgagcttttaggttgacaatcaaact
tatatcatcttaaagagtatgagtttcgcagaattcatggagtaagaacaactctctccc
actactcatgttccattattgatttcgaaaaaggataaaaaacaagctcaagtctaatta
gatcttacataaaagatatcaagatacacatataaacatgaaattaaatttataaaacca
atcgtccttggaactgatatttatttgatttgctttttgtaaagtgttgatattgtgttg
ttgtgtaatccaattgtatgttaagtctcttagaataacacaatagcagaaatggtcaat
aggattatataagatgttagttaggctcctatttaatacaaatcttaatcgatttagatc
actgaggactttatttatagttcagaggataacaagaccagaagactagaataacaaatt
agagttcgaattaataattaagaaatttaataggatactcaaatgggaattggatctctt
atgcctgaacttaaacaattgacactcgtaatgacttttctgactattagagatacaaag
gttgataaattgaggtaaaagggagtctaaattttttga

DBGET integrated database retrieval system