KEGG   Paramecium tetraurelia: GSPATT00025946001Help
Entry
GSPATT00025946001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ptm  Paramecium tetraurelia
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    GSPATT00025946001
Protein phosphatases and associated proteins [BR:ptm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     GSPATT00025946001
Ubiquitin system [BR:ptm04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     GSPATT00025946001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 405 aa AA seqDB search
MQFKIFNNKIEHQQKKISAKMVPTPGVGYQNYQSLLSQSFQFSQNQNKNFNPKKSDIQKV
NTAAIQQFPSLINLPQLLKLFAHPYYLWTNYSVEAIANFQKLPPQHYKSGWVLEKVARSF
MDQVKYADAEKVWKEMRQIEPNRLEGMDYYSSCLWHLKKQSELTYLAYSCSQISMLAPET
WIAIGNCFSLSKEIDNSIKFFGRAIQLRKDYSYAYTLSGHEFSQNENFQQAKKSYDMATS
LDQRQYNAWWGQGNMYYKTDKYDDAIRCFTQALKINSNNPVLPTFLAMSYAAKGEHAEAL
KYFEQSEKLDPQNGLNKYQKANSLIKLDQYDDALSELQRLRELIPKEAAIYILMGRIYKK
LGKIQEAQNCFSTAMSLDQKDSAKIKGLMESLNNPNSEFNDDFDL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtaatttaaaatatttaacaacaaaatagagcatcaacaaaagaaaatcagtgccaaa
atggtaccaactccaggagtaggatactagaattattagtctttactcagtcagtctttt
taattctcacagaattagaataagaatttcaatccaaaaaaaagcgacattcaaaaagta
aacacagcagcaatataataatttccaagtctgatcaatctgccttaacttttgaaattg
tttgcccatccttattacttatggacaaattactcagtggaagcgattgctaatttctag
aagttacctccgcaacattataaatcaggttgggtgcttgaaaaagtagccaggagtttt
atggatcaagtgaaatatgctgatgcagagaaagtttggaaggaaatgagacaaatagag
ccgaatcgcttggaaggtatggattattattcatcttgcttatggcatctgaaaaaacaa
tcagaattgacatacttagcttattcatgttcgtaaatcagtatgctagcacctgaaacc
tggatagctattggaaattgctttagtttaagtaaggaaatagacaactcaataaaattc
ttcggaagagctatttagttaagaaaagattattcttatgcttataccctatcaggtcat
gagttctcacaaaatgaaaacttccagtaggctaagaaatcttatgacatggccacttcc
ttagaccagagataatacaatgcttggtggggacagggaaacatgtactataagactgac
aaatatgacgatgccatcagatgtttcacgtaggccttaaagataaactcaaacaatcca
gttctaccaacatttttggctatgagttacgctgccaagggagagcatgctgaggctttg
aaatacttcgaacaaagtgaaaaattagacccgcaaaatgggttaaataagtactagaaa
gctaattcattaataaaattagattaatacgatgatgccttaagtgaattgtagagattg
agagaattgataccgaaagaagcagcaatttacatcttgatggggcgaatctataagaaa
ctggggaagatttaagaagcatagaattgtttcagcactgcaatgtcacttgattaaaag
gattccgcaaagatcaaagggttaatggagagtttaaataatccgaatagcgaattcaac
gatgattttgatttatga

DBGET integrated database retrieval system