KEGG   Paramecium tetraurelia: GSPATT00026616001Help
Entry
GSPATT00026616001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
ptm  Paramecium tetraurelia
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    GSPATT00026616001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     GSPATT00026616001
Peptidases [BR:ptm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GSPATT00026616001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 484 aa AA seqDB search
MNTEQRFQPKLSRILDVNYKQIPNKFRKQATQRRIQQNNQFETESQGLLGLTNLGNTCFL
NSSIQALSNTQPLTDYFMSQLHVKEINPDNPLSSQGNIVQSFAQLIRLLWQKVDQYTLEE
IQALKPTQFISTIGNYNPIFAEGTQEDAHEFIAFLLDMIHEDLNRIKKKPYVEQTKFTKL
PTNDDAHQEWTKYLSRNQSIIVDLFQGHMLDTLSCLTCKSSRYCFEPFMYLSVPVLSREC
DLLECIEEFLKTETLTGDEGWNCTKCSQRRDSNKKIDLWSMPNILIIHLKRFKFNSQFRA
KIRSLVRYPLQNLSFENLVCTKQIEKPTYDLYAVINHSGTLTSGHYTAYAKNRDDLQWYH
YNDSLVSPVSQPENQSDAYLLFYFKNSVEEFKRQTLEGVNVSQQRRSIINTIVVKQTMLN
VHSQQSNSNISENKRNNNNFFVPSISSQAQKRMLFRRQTKHFQIVKAQDQPSFQQDSIII
QEEN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagaacaacgctttcaacctaaacttagtcgcattttggatgtaaattacaaa
tagatcccaaataaatttagaaagtaggctacataaagaagaatccaataaaataatcaa
ttcgaaactgaatcttaaggattgttaggattgaccaatctaggaaatacctgcttttta
aattcatctatctaagccttatcaaatacataaccactaactgattatttcatgtcataa
ctccatgtgaaagagataaatcctgacaatcccctctctagttaaggcaacatagtccaa
tcatttgcctaactcattagactactatggtagaaagtagattaatatactcttgaggaa
atataggctttgaaaccgacacaattcatatcaacaatcggaaattataatcctatattt
gcagaaggtacctaagaagatgcccatgagtttattgcttttctcttagatatgattcat
gaagatttgaatagaattaaaaagaaaccttatgtagaataaactaaatttaccaaactc
ccaactaatgatgatgcgcatcaagaatggactaagtatctatctagaaattagtccatc
attgttgatttattttagggacacatgcttgacaccttatcttgcttaacatgtaagtca
tctagatattgctttgaaccttttatgtatttgagtgtgcctgtgttgagtagagaatgt
gatttattggaatgcattgaggaattcctgaaaacagaaactctcacaggcgatgaagga
tggaattgcaccaagtgttcataaagaagagacagcaataaaaagattgacttatggagt
atgccaaacattctgataatacacctaaaacgatttaaatttaattcttaattcagagct
aaaatcaggtcattagtcaggtatcctttatagaatttatcatttgaaaatcttgtttgt
acaaaacaaatagaaaaaccaacctatgatctctatgcagttatcaatcatagtggcaca
ctaacatcgggacattacactgcttatgccaaaaacagagatgatttgcaatggtatcat
tataatgactctctagtatcaccagtttcataaccagaaaattaatctgatgcttactta
ttgttttattttaaaaatagtgttgaagaattcaaaaggtaaacgctcgaaggagtcaat
gttagctaatagcgaagatctataataaatacaatagtggtcaaataaaccatgcttaac
gtgcattcccaataatctaatagcaacatctctgagaataaaaggaacaacaacaacttt
tttgttccatctatttcaagtcaagcttaaaaaagaatgctgtttagaagataaactaag
cattttcaaattgttaaagcacaagatcagccttcattctaataggactctatcataata
taggaagaaaactga

DBGET integrated database retrieval system