KEGG   Paramecium tetraurelia: GSPATT00026616001Help
Entry
GSPATT00026616001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ptm  Paramecium tetraurelia
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ptm04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 484 aa AA seqDB search
MNTEQRFQPKLSRILDVNYKQIPNKFRKQATQRRIQQNNQFETESQGLLGLTNLGNTCFL
NSSIQALSNTQPLTDYFMSQLHVKEINPDNPLSSQGNIVQSFAQLIRLLWQKVDQYTLEE
IQALKPTQFISTIGNYNPIFAEGTQEDAHEFIAFLLDMIHEDLNRIKKKPYVEQTKFTKL
PTNDDAHQEWTKYLSRNQSIIVDLFQGHMLDTLSCLTCKSSRYCFEPFMYLSVPVLSREC
DLLECIEEFLKTETLTGDEGWNCTKCSQRRDSNKKIDLWSMPNILIIHLKRFKFNSQFRA
KIRSLVRYPLQNLSFENLVCTKQIEKPTYDLYAVINHSGTLTSGHYTAYAKNRDDLQWYH
YNDSLVSPVSQPENQSDAYLLFYFKNSVEEFKRQTLEGVNVSQQRRSIINTIVVKQTMLN
VHSQQSNSNISENKRNNNNFFVPSISSQAQKRMLFRRQTKHFQIVKAQDQPSFQQDSIII
QEEN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagaacaacgctttcaacctaaacttagtcgcattttggatgtaaattacaaa
tagatcccaaataaatttagaaagtaggctacataaagaagaatccaataaaataatcaa
ttcgaaactgaatcttaaggattgttaggattgaccaatctaggaaatacctgcttttta
aattcatctatctaagccttatcaaatacataaccactaactgattatttcatgtcataa
ctccatgtgaaagagataaatcctgacaatcccctctctagttaaggcaacatagtccaa
tcatttgcctaactcattagactactatggtagaaagtagattaatatactcttgaggaa
atataggctttgaaaccgacacaattcatatcaacaatcggaaattataatcctatattt
gcagaaggtacctaagaagatgcccatgagtttattgcttttctcttagatatgattcat
gaagatttgaatagaattaaaaagaaaccttatgtagaataaactaaatttaccaaactc
ccaactaatgatgatgcgcatcaagaatggactaagtatctatctagaaattagtccatc
attgttgatttattttagggacacatgcttgacaccttatcttgcttaacatgtaagtca
tctagatattgctttgaaccttttatgtatttgagtgtgcctgtgttgagtagagaatgt
gatttattggaatgcattgaggaattcctgaaaacagaaactctcacaggcgatgaagga
tggaattgcaccaagtgttcataaagaagagacagcaataaaaagattgacttatggagt
atgccaaacattctgataatacacctaaaacgatttaaatttaattcttaattcagagct
aaaatcaggtcattagtcaggtatcctttatagaatttatcatttgaaaatcttgtttgt
acaaaacaaatagaaaaaccaacctatgatctctatgcagttatcaatcatagtggcaca
ctaacatcgggacattacactgcttatgccaaaaacagagatgatttgcaatggtatcat
tataatgactctctagtatcaccagtttcataaccagaaaattaatctgatgcttactta
ttgttttattttaaaaatagtgttgaagaattcaaaaggtaaacgctcgaaggagtcaat
gttagctaatagcgaagatctataataaatacaatagtggtcaaataaaccatgcttaac
gtgcattcccaataatctaatagcaacatctctgagaataaaaggaacaacaacaacttt
tttgttccatctatttcaagtcaagcttaaaaaagaatgctgtttagaagataaactaag
cattttcaaattgttaaagcacaagatcagccttcattctaataggactctatcataata
taggaagaaaactga

DBGET integrated database retrieval system