KEGG   Paramecium tetraurelia: GSPATT00026784001Help
Entry
GSPATT00026784001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     GSPATT00026784001
Protein kinases [BR:ptm01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   GSPATT00026784001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 377 aa AA seqDB search
MSKKIKISQPLPKVNWKDTDMEEELTIKIPHGDLINKIIDPRSSPQEFFVPLRFPAQQHM
KDADGFFIPLPKEDPKKILQQQQQFQNERYQIQLQDLISIDDLGQGSSGRVIKALHRPTN
LLVALKTIQIVNDEKFTKQINLELETLVSCNHSNIIRCYGAFLEGAQVAIALEYMNLGTL
QDVIKKSGKIPEGMLGLIAYQLLKGLDYLHRTKKIIHRDIKPSNLLINSQGEVKISDFGV
SGQLLNTQDQRCTWVGTVTYMSPERFLCEPYSSNTDVWSLGLSLLECAWGVFPYPHPGTN
DTTHSLGFWEIKEYIVSRPAPPSPPDFSQIGADFIASCLQKDPRQRRSAAELLEHPFIKQ
FEDVSLQYLEGWLNINQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaaattaaaatttcttaacctctaccgaaagtcaattggaaagatactgat
atggaagaagaactcaccatcaaaatacctcatggtgatctaatcaacaaaatcatagac
cctagatcaagtcctcaggaattctttgttccattaagatttccagcctaataacacatg
aaagatgcagatggctttttcatacccttgcctaaggaagatccaaagaaaatactataa
caatagcaacaatttcaaaatgaaagatattaaattcaattgcaggatttgatatccatt
gatgacttgggtcaaggctcaagcggaagagtgatcaaagcattacatagacccactaat
ttgcttgttgcacttaaaacaatccaaatagtgaatgatgaaaaattcactaaataaatc
aatttggaactggaaactttggtcagttgcaatcattcgaacatcatcagatgttatgga
gcttttctagaaggagcttaggtagcaatcgctttagaatacatgaatttaggcactttg
caagatgtaattaagaagtcaggaaaaatccctgaaggcatgttaggactcattgcctat
taactactcaaaggtttggactatttacatcgaacaaagaaaatcatccatagagatatc
aagccttcaaatttattgataaatagttaaggggaagttaaaatctctgattttggtgta
agcggctaattactaaacacctaagaccagcgatgtacttgggttggtacagttacttat
atgtctcctgagagatttctgtgtgagccctactcttcgaatacagatgtctggtcctta
ggactctctttacttgaatgcgcttggggggttttcccttatcctcatcctggaaccaac
gatactactcactcccttgggttttgggaaatcaaagaatacattgtttcaagaccagct
cctccatcacctcctgatttttcctaaattggagctgacttcatagccagttgtttataa
aaagatccaaggtagaggaggagtgctgcagaattgctggaacacccttttattaaacaa
tttgaggatgtgagtctacaatatttagaaggttggcttaacattaattaatga

DBGET integrated database retrieval system