KEGG   Paramecium tetraurelia: GSPATT00026938001Help
Entry
GSPATT00026938001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ptm  Paramecium tetraurelia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSPATT00026938001
   01230 Biosynthesis of amino acids
    GSPATT00026938001
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSPATT00026938001
   00030 Pentose phosphate pathway
    GSPATT00026938001
   00051 Fructose and mannose metabolism
    GSPATT00026938001
   00052 Galactose metabolism
    GSPATT00026938001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GSPATT00026938001
Protein phosphatases and associated proteins [BR:ptm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSPATT00026938001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 1144 aa AA seqDB search
MIIQPNNFHSLRTKYQPELPQLLQLEELDTKTETIQVNPQIREMFPFLCKEEVKAVAFQA
ANANENTIRAPLRIGCVLSGGQAAGGHNVIVGIYEQIKRRHPNSQLFGFLKGPIGIYSGK
YEELKDDTINYFKNRGGFDMIQSGRHKIETEEQFKKSLQYCQSLKLDGLVVIGGDDSNTN
ACLLAEYFLKNNCQTSVVGCPKTIDGDLKNEFVEVSFGFDTACKTYSELIGNIMLDTVSS
KKYYHFIRLMGRSASHIALECALLTRPTWAYIGEEVEKNKTSLTQIVTQLSDLIEKRYKQ
NKNHGVILVPEGLIEFIDEVKILIKEINTILAANKWEPDQVFNNILTKLTPESSKLLEFL
PRSISDQLLLDRDPHGNVQVAKIETEKLLIEMVKAELERRKYGGKFSAISHYYGYEGRCA
FPTKFDCDYCYSLGVNAAILIENKFTGVMSCIRDLHKSPSEWNAAGFPLVTMMDVETRKG
KSVPVIKKALVDLDGPLFKFYQSNREKWAFHDYYHPVGPIQFEGDQVPPFLINGKGFEFE
EVDNKIYEQKPYEEMHLRNLSKLGLDRSNTPLSLPKHLNLKLSLKVIHHNYSDNVMKAIE
KHFPSLMAKSINAFQLLHDDAHEAHNKPLRIGITLNGRQSPGANCIIRGLLALCEQSGST
LYGFIGGTQGLFKQEYLEINQNSLQYYINQGGYHYLGRTADKMRSVQELQQVKETCNILS
LDGLVVVGASHTLTDCIIVANYLLQENVKTRVIGVPCTVDNNIGHPFLEGIVGFDTASKT
YSQMIGNIMIDAASAVKYWYFIRLMGRDPSHLVLECALQTHPNVVLISEDIKERGLTLQE
VVSEIADVVVLRSQKNKEFGTVLVPEGLLAHIGQFKQLITELDKHFATNKQDIMNNLTPW
SAALFQSLPDFTQQQLLMEREVHGGIQLSQIETERLLAHLVAEELKVRKAESKYKGSFSP
ICHFFGYQGRCAFPTRFDAKLGEVYGYLAGLSIQRGLTGYCVSARGIAGPIERWHFNLIP
LLGMISIKQKSAYGEAQPIIASYEVDLKQSLFKHFSQISKNWYLKDHYENPGPIQFYGPM
ARRPTLTVELSYKCYVDQIEEIERLVEVISEQCRFETRADLLDLAIAQLKALARTIEVVK
EAKQ
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgattattcaacccaataactttcatagtctcagaaccaaatattagcctgagttacca
caattattgtaattggaagagttggacaccaaaacagagacaatttaagtgaatcctcaa
attcgagaaatgtttccctttttgtgcaaggaagaagttaaggcagtcgcattttaagct
gcaaatgctaatgagaatacaataagagcacctttgagaattggttgtgtgctctcagga
ggttaagcagctggtggtcacaacgtcatagtggggatttatgaacaaataaagagaaga
catccaaatagttaattgtttggatttttgaaggggccaattggtatttactcaggcaag
tacgaggaattgaaagatgatactatcaattatttcaagaatagaggagggttcgatatg
attcaaagtggaagacacaagattgaaacagaagaacaattcaagaagtctcttcaatat
tgttaatcattaaaactagatggtttggtagtgatcggaggagatgactcaaacactaat
gcttgcttattggcagagtatttcttgaagaataattgttaaacaagtgttgttggttgt
ccaaagacaattgatggagatctaaagaatgagtttgttgaagtaagttttggatttgac
acagcatgtaaaacatacagtgaacttattggaaatatcatgttggatactgtatcctct
aagaaatactatcacttcatccgtttgatgggtagatctgcatctcatattgcattggag
tgtgcacttttaacaagacccacttgggcttatattggagaggaagtagagaagaataag
acctcattgacataaatagttacttaattgagcgatttgattgagaagagatataagtaa
aataagaatcatggagtcattttagtaccagaaggattgattgagtttatcgatgaagta
aagatattgatcaaagaaattaatacaatattggcagctaacaaatgggaaccagattaa
gtatttaataatatcttgactaaattaacacctgaatcatcaaaactattagaattctta
ccaaggagtattagtgattaattgttacttgatcgtgatccacatggaaatgttcaagtg
gctaaaattgaaactgaaaagctattgattgagatggttaaagctgaattggaaagaaga
aagtatggtggtaaattctcagccatcagtcattattatggatatgaaggtagatgtgca
ttccctactaaatttgattgcgattattgttacagtttgggtgttaatgcagctatctta
attgagaataaattcactggagttatgagttgcattcgtgatttacacaaaagtccatct
gaatggaatgctgctggtttcccattggtaactatgatggatgtggagactagaaaaggg
aaatctgttccagtcattaaaaaagcattagttgatcttgatggaccactattcaaattc
tattaatcaaatagagagaaatgggcattccatgattattatcatcctgttggaccaatc
taattcgaaggtgattaagtacctcccttccttatcaatggcaaaggatttgaatttgaa
gaagtggacaataaaatttatgagcaaaaaccttatgaagaaatgcatcttagaaattta
tcaaagttgggattggacagatcaaatactcctttgtctctcccaaaacacctaaatctt
aagttaagtcttaaggtcatccatcacaactacagtgataatgtcatgaaagccattgaa
aagcattttccatctcttatggccaaaagtataaatgcattccaacttttacacgatgat
gctcatgaagcacataataaaccattaagaattggtattacattgaatggtcgacaatct
ccaggagcaaattgcatcattagaggattattggcattgtgtgagtaaagtggatctaca
ttatatggattcattggaggtacctaaggtctattcaaataagaatatcttgaaatcaat
tagaatagtctacaatactatattaactaaggtggatatcattatctaggtcgtactgca
gataaaatgagatctgtataagaattacaataagttaaagaaacttgcaacatcctatct
ttagatggattagttgtagtaggtgcttcacacacactcacagattgcataatagttgcc
aactatttactgtaagagaatgtcaagaccagagttattggagttccatgcacagtcgat
aataatattggccatccatttttagaaggcattgttggttttgacactgcttctaagacc
tattcctaaatgatcggtaatatcatgatagatgctgccagtgctgtcaaatattggtac
ttcattagattaatgggaagagatccttcacatcttgtgttagaatgtgcactttaaact
catccaaatgttgttctcatcagtgaagatattaaagaaagaggacttactttacaagaa
gtggtctcagaaattgcagatgtggttgtacttagatcatagaaaaataaagaatttggt
actgttcttgtacctgaaggtttattggcccacattggataattcaaataattaattacg
gaattggataagcatttcgcaaccaataaacaggatataatgaataatttaactccttgg
tctgcagctctattctaatccctcccagatttcacttaacagtagttgcttatggaaaga
gaagtacatggaggcatccaattatcgcaaattgaaactgagagattattagctcatttg
gttgctgaagaactcaaagtcagaaaagcagaatcaaaatacaagggttcattttcacct
atttgtcactttttcggatatcaaggtagatgcgcattccctactcgattcgatgccaag
ttaggagaagtctatggttatttggcaggtttaagcatctaaagaggattgactggctat
tgtgtttctgccagaggaattgcaggtcccattgagagatggcatttcaatttaatccca
ctcttaggaatgatatccatcaaatagaagagtgcatatggagaagcataacctattatt
gctagttatgaagtggatttgaaatagtcgctctttaaacatttcagccagatttctaag
aattggtatttgaaagatcactatgagaatccaggcccaatctaattctatggacctatg
gctcgtagaccaactttgactgttgaattgagctataaatgctacgtggattagattgag
gagattgagcgcctagtcgaggtgatatctgaacaatgcagatttgaaaccagggctgac
ttgcttgatttagctattgctcaattgaaagctttggctagaacaatagaagtagtgaag
gaggcaaaacagtga

DBGET integrated database retrieval system