KEGG   Paramecium tetraurelia: GSPATT00026938001Help
Entry
GSPATT00026938001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ptm  Paramecium tetraurelia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ptm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ptm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ptm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ptm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ptm00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ptm00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 1144 aa AA seqDB search
MIIQPNNFHSLRTKYQPELPQLLQLEELDTKTETIQVNPQIREMFPFLCKEEVKAVAFQA
ANANENTIRAPLRIGCVLSGGQAAGGHNVIVGIYEQIKRRHPNSQLFGFLKGPIGIYSGK
YEELKDDTINYFKNRGGFDMIQSGRHKIETEEQFKKSLQYCQSLKLDGLVVIGGDDSNTN
ACLLAEYFLKNNCQTSVVGCPKTIDGDLKNEFVEVSFGFDTACKTYSELIGNIMLDTVSS
KKYYHFIRLMGRSASHIALECALLTRPTWAYIGEEVEKNKTSLTQIVTQLSDLIEKRYKQ
NKNHGVILVPEGLIEFIDEVKILIKEINTILAANKWEPDQVFNNILTKLTPESSKLLEFL
PRSISDQLLLDRDPHGNVQVAKIETEKLLIEMVKAELERRKYGGKFSAISHYYGYEGRCA
FPTKFDCDYCYSLGVNAAILIENKFTGVMSCIRDLHKSPSEWNAAGFPLVTMMDVETRKG
KSVPVIKKALVDLDGPLFKFYQSNREKWAFHDYYHPVGPIQFEGDQVPPFLINGKGFEFE
EVDNKIYEQKPYEEMHLRNLSKLGLDRSNTPLSLPKHLNLKLSLKVIHHNYSDNVMKAIE
KHFPSLMAKSINAFQLLHDDAHEAHNKPLRIGITLNGRQSPGANCIIRGLLALCEQSGST
LYGFIGGTQGLFKQEYLEINQNSLQYYINQGGYHYLGRTADKMRSVQELQQVKETCNILS
LDGLVVVGASHTLTDCIIVANYLLQENVKTRVIGVPCTVDNNIGHPFLEGIVGFDTASKT
YSQMIGNIMIDAASAVKYWYFIRLMGRDPSHLVLECALQTHPNVVLISEDIKERGLTLQE
VVSEIADVVVLRSQKNKEFGTVLVPEGLLAHIGQFKQLITELDKHFATNKQDIMNNLTPW
SAALFQSLPDFTQQQLLMEREVHGGIQLSQIETERLLAHLVAEELKVRKAESKYKGSFSP
ICHFFGYQGRCAFPTRFDAKLGEVYGYLAGLSIQRGLTGYCVSARGIAGPIERWHFNLIP
LLGMISIKQKSAYGEAQPIIASYEVDLKQSLFKHFSQISKNWYLKDHYENPGPIQFYGPM
ARRPTLTVELSYKCYVDQIEEIERLVEVISEQCRFETRADLLDLAIAQLKALARTIEVVK
EAKQ
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgattattcaacccaataactttcatagtctcagaaccaaatattagcctgagttacca
caattattgtaattggaagagttggacaccaaaacagagacaatttaagtgaatcctcaa
attcgagaaatgtttccctttttgtgcaaggaagaagttaaggcagtcgcattttaagct
gcaaatgctaatgagaatacaataagagcacctttgagaattggttgtgtgctctcagga
ggttaagcagctggtggtcacaacgtcatagtggggatttatgaacaaataaagagaaga
catccaaatagttaattgtttggatttttgaaggggccaattggtatttactcaggcaag
tacgaggaattgaaagatgatactatcaattatttcaagaatagaggagggttcgatatg
attcaaagtggaagacacaagattgaaacagaagaacaattcaagaagtctcttcaatat
tgttaatcattaaaactagatggtttggtagtgatcggaggagatgactcaaacactaat
gcttgcttattggcagagtatttcttgaagaataattgttaaacaagtgttgttggttgt
ccaaagacaattgatggagatctaaagaatgagtttgttgaagtaagttttggatttgac
acagcatgtaaaacatacagtgaacttattggaaatatcatgttggatactgtatcctct
aagaaatactatcacttcatccgtttgatgggtagatctgcatctcatattgcattggag
tgtgcacttttaacaagacccacttgggcttatattggagaggaagtagagaagaataag
acctcattgacataaatagttacttaattgagcgatttgattgagaagagatataagtaa
aataagaatcatggagtcattttagtaccagaaggattgattgagtttatcgatgaagta
aagatattgatcaaagaaattaatacaatattggcagctaacaaatgggaaccagattaa
gtatttaataatatcttgactaaattaacacctgaatcatcaaaactattagaattctta
ccaaggagtattagtgattaattgttacttgatcgtgatccacatggaaatgttcaagtg
gctaaaattgaaactgaaaagctattgattgagatggttaaagctgaattggaaagaaga
aagtatggtggtaaattctcagccatcagtcattattatggatatgaaggtagatgtgca
ttccctactaaatttgattgcgattattgttacagtttgggtgttaatgcagctatctta
attgagaataaattcactggagttatgagttgcattcgtgatttacacaaaagtccatct
gaatggaatgctgctggtttcccattggtaactatgatggatgtggagactagaaaaggg
aaatctgttccagtcattaaaaaagcattagttgatcttgatggaccactattcaaattc
tattaatcaaatagagagaaatgggcattccatgattattatcatcctgttggaccaatc
taattcgaaggtgattaagtacctcccttccttatcaatggcaaaggatttgaatttgaa
gaagtggacaataaaatttatgagcaaaaaccttatgaagaaatgcatcttagaaattta
tcaaagttgggattggacagatcaaatactcctttgtctctcccaaaacacctaaatctt
aagttaagtcttaaggtcatccatcacaactacagtgataatgtcatgaaagccattgaa
aagcattttccatctcttatggccaaaagtataaatgcattccaacttttacacgatgat
gctcatgaagcacataataaaccattaagaattggtattacattgaatggtcgacaatct
ccaggagcaaattgcatcattagaggattattggcattgtgtgagtaaagtggatctaca
ttatatggattcattggaggtacctaaggtctattcaaataagaatatcttgaaatcaat
tagaatagtctacaatactatattaactaaggtggatatcattatctaggtcgtactgca
gataaaatgagatctgtataagaattacaataagttaaagaaacttgcaacatcctatct
ttagatggattagttgtagtaggtgcttcacacacactcacagattgcataatagttgcc
aactatttactgtaagagaatgtcaagaccagagttattggagttccatgcacagtcgat
aataatattggccatccatttttagaaggcattgttggttttgacactgcttctaagacc
tattcctaaatgatcggtaatatcatgatagatgctgccagtgctgtcaaatattggtac
ttcattagattaatgggaagagatccttcacatcttgtgttagaatgtgcactttaaact
catccaaatgttgttctcatcagtgaagatattaaagaaagaggacttactttacaagaa
gtggtctcagaaattgcagatgtggttgtacttagatcatagaaaaataaagaatttggt
actgttcttgtacctgaaggtttattggcccacattggataattcaaataattaattacg
gaattggataagcatttcgcaaccaataaacaggatataatgaataatttaactccttgg
tctgcagctctattctaatccctcccagatttcacttaacagtagttgcttatggaaaga
gaagtacatggaggcatccaattatcgcaaattgaaactgagagattattagctcatttg
gttgctgaagaactcaaagtcagaaaagcagaatcaaaatacaagggttcattttcacct
atttgtcactttttcggatatcaaggtagatgcgcattccctactcgattcgatgccaag
ttaggagaagtctatggttatttggcaggtttaagcatctaaagaggattgactggctat
tgtgtttctgccagaggaattgcaggtcccattgagagatggcatttcaatttaatccca
ctcttaggaatgatatccatcaaatagaagagtgcatatggagaagcataacctattatt
gctagttatgaagtggatttgaaatagtcgctctttaaacatttcagccagatttctaag
aattggtatttgaaagatcactatgagaatccaggcccaatctaattctatggacctatg
gctcgtagaccaactttgactgttgaattgagctataaatgctacgtggattagattgag
gagattgagcgcctagtcgaggtgatatctgaacaatgcagatttgaaaccagggctgac
ttgcttgatttagctattgctcaattgaaagctttggctagaacaatagaagtagtgaag
gaggcaaaacagtga

DBGET integrated database retrieval system