KEGG   Paramecium tetraurelia: GSPATT00027458001Help
Entry
GSPATT00027458001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
ptm  Paramecium tetraurelia
Pathway
Autophagy - other
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Cellular Processes
  Transport and catabolism
   04136 Autophagy - other eukaryotes
    GSPATT00027458001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSPATT00027458001
Protein kinases [BR:ptm01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   GSPATT00027458001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 2462 aa AA seqDB search
MQKPELQRIFKDLAAKVPNEQKEKAAMELQSVYYKYIQQSDELFNKIQKLINSSEIHEKF
GGILALDQLTTTVQEAQALTFVNKFIPNVSGQFIYNDEKFLRKSAEVFGKLLRLGGTKIA
QVVDSHFVEAQNQLKSEKYKLAGVLCLKEILNEAASITFNKLFQTMQTDRNFTLIHGAIR
SKQYSLREAALDLFSEIVKQIAQREYYLVKIYTDEIESRKKSKEEEYIHGNIMMIKILLT
YAKQDVFSQQQIYDQGEYVLSKKDHKSIIINRAVIETLPILAKHAKHHAVQEFMEQSISF
LLSQTVQARSVKDKSLPYMTLAMLISFLNENMLQDLIRKVILHIRQELLQKNFCVEMIHC
LQVIFQNYTRKFAEFTSVDVLVDQILLNGLHPQSVQFLNQLCRQQPRQSDYIQQKLLQTI
AAILLRKIINFVNPKQQNFDGSILNDFQGYLQKAITTTEFRSPEAIANAIQTLSTFSFDL
QDSLAIFVKDAVLPNLANSNPIIRKATAKAGCLLYIKKGRSTGQQMISKNVMYEILDKFM
NVAISDTEQDIRQTMLASLNENFDPYLNSPNNLRKLFLCMNDPISEVQEIALTILCRLSI
LNPSEIIPFLKKTLFEYLQTLTFDSNQPEKQTINKLYLLTSLIKHGRTIVQPYTSNIAKV
IQQHLKNPNTNAIVTSYLLKAFAQLTETANQEILVNLKEVFDIIITAMQDKSSTLKREAA
VKSLNLIIKNTGFVVLPYYRFPNLMDVIFQLIRTETIPEMRQECLKLLGNLGAVDSFIYK
SVQGVPTKQKFKFLKNYQNALNSVSSSELMNEVRGYSEDLILIGNFSSKMFLHLGKLKMQ
TDQDTLLYQNNNALITKSVTLDTQSHYHQAINSQDIEELFQQVPVIQLNDIDYYSKVTLK
TLLQILLDPSLSNNHELALETIMWIIGTLKAKTASYLNYLIPVFARLLQRNEEMKEKVLT
SLQKVIHLCGIQFNPQYIDQVIACVMLFCQGQESSKLVLIGLEIMETLIKSSKPHLRHKV
EPLVRLINQEISQFEEEKDLVRKGIKIYILLENLLDCQLHMFIPFMCKLLSKEVSSVLLE
VRKDIINLFVSLSRKCPTTVQYLSLIVNSLLNLVELSAKTQQQLEMHQTVLNCIVNLILQ
HKNLMLVYLPMIHLQVQKYKIHHQQYQKLVEIFLMYGNLEDLNNLLDEDCKAIEQLFPSQ
ITQYYSIEPNAPMYKKIEPEELVAKFDTEQRNLKEEWQEWMRNTSVELLKLSPFLVLSPC
SSIAEMYQTLAYELFNIAFDSAWYFLNDKHKELMVQYLVRVIKADNIPLQISQTILNLAE
FMQHDKEGLQIDISSLGELAEKCMAYAKALYYREHEFETANSKAIQSLISLYTNLGLQES
ANGLLTYAKQSLKIQVQNTDYERLKKWDEALQEYRQQQLKYENDQRMDLAIKLVVPKMRC
LNALMQWQTLISQAEEIFKSNEDAKQKEIAHLAANAAMHLGQWDKLATYNEQVNAEESDK
PFWKAAVCISKGQLDEAKIQVRKSRERLDGLVTGLLQESYDRAQDGVLKLQQLVEMEEII
EIKQFENKVQKAAQENVGEYSYIKLLDELEIRKKKLKDIWHDRLSGAPKDIDVWYRLLST
RQLYLPKVHDLDIWIKFAKLCLKRQKMVLCKSTIEILKEQFQNQGLAPLPVTLHIFNMQF
EYVHAKHEIQILDQVREYFTNQEQISSIDSKLKAKTFFTLGKWAYERAESTSDLEQITKQ
FDESLQYNSTYAKAWHYYGLCNFEVIEQQENRQSMNAHVFAAVKGFLKSISLGSRDIKKG
RYILQDTLRLLSLIFKYGMEAAISDEFRQNYKQIDVIAWIDVIPQILARIQIQNPIIQQL
LQDLLIHISRIHPQALIYPLTVACKSKNQIKRLQVLKILDDMKKHSPILVNEALIISEEL
NRTAILLKEAWREGIQEAWTSFSQDKNKTHVERILRGLHDNMRVKLESLSEISFHQTYGQ
EIFEAEAWLQRYLRTEDQVCLCVAFDIYTRIYHKVQKSLEKMKKVHLENVSPKLLATQNC
EISIPGLYKTNKQLITINGFAPRLDVLSSKQHPRQVKIFGNDSKEYQFLLKGHEDLRQDE
RVMQLFSLVNRLLTNDTETERKDLTITRYSVIPLSHNTGLLGWVQNCDTLQQLVREYRDK
YAIRSNAESTLMEQFCAQYQNLPLPNKVEIYRHILENTRGEDLQKVLWIKSPNSEVWLER
RINYTRSLATMSMGDRHPSNFMLQRLTGKIVHIDFGDCFEVAMKREKYPERVPFRLTRML
VKAMEACGIEGVYRHTCNIVMRVLRENKESLLAVLDSFVYDPLLTWRLLNAQDHKPKKEA
RNVDLHKQIPHQGKSLIQVIPEAKRRGSIIDDGKQQQTLKRKESGREKEIYFEFADEERE
IPDDLQNQKGLEVIERIKKKLQGRDFKEHEVLSTESQVNQLILQATNHENIAQAYLGWCP
FW
NT seq 7389 nt NT seq  +upstreamnt  +downstreamnt
atgtagaaaccggaattgcagagaatttttaaagaccttgctgcaaaagtgcctaatgaa
taaaaggagaaagcagccatggaattgcagagtgtctactacaaatacattcaatagagt
gatgaattgttcaacaagattcagaaactcataaatagttctgagattcacgagaaattt
ggaggcattttggccttggattaattgacgacaactgtgtaggaggctcaagcattaacc
tttgtaaacaagtttattccgaatgtgtcaggtcaattcatctataatgatgagaagttt
ttgaggaagagtgcagaagtctttggaaaattactcagattgggtggaactaagatagct
caagtggtggattcacattttgtggaggcataaaactaattgaaaagtgaaaaatataaa
ttagctggcgtactttgtttgaaagaaatattaaatgaggctgcttcaatcacttttaat
aagctattttaaactatgcagacggatcgcaattttacactcattcatggtgccatcaga
tcaaaataatattccttacgagaagcagctctcgacttattcagtgaaattgtaaaacaa
attgcataaagagaatattacctagtgaaaatatatactgatgaaattgaatctagaaaa
aaatcaaaggaagaagaatacatccatggcaatattatgatgatcaaaatattactcacc
tatgccaaataagatgtcttttcacaacaacaaatctatgattaaggagaatatgttctc
tcaaaaaaagatcacaaatcaatcatcatcaacagggctgtgatagaaacactaccaatc
ttggccaaacatgctaaacatcatgcagtccaggaattcatggaacaaagcatatccttt
ctattatcatagactgtgcaagccagatctgtgaaggacaaaagtctaccctacatgact
ttggccatgctcatctcatttttgaatgagaacatgcttcaagatctaattagaaaggtg
atcttgcacattcgtcaagaattgctacagaagaacttttgtgttgaaatgattcactgc
ttataagtcatattttagaactatacaaggaagtttgcagaattcacatcagttgatgtc
ctagtagattaaatactcttaaatggcttgcatccacaatcagtctaatttcttaattaa
ttatgcagataataacccagacaatctgattacattcaataaaagctcttataaacaatt
gcagccattcttctgagaaagattatcaactttgtcaatccaaaataatagaactttgat
ggcagcatcctgaatgatttttaagggtacttacaaaaagccattaccacaacagaattc
agatctcctgaagccattgctaatgccattcaaacactcagcactttctcatttgattta
taggacagtcttgcaatatttgtgaaggatgccgtactacccaatcttgctaattctaat
ccaatcataaggaaggctactgcaaaagcaggatgtctgttgtacataaagaaagggaga
tcgacagggtagtagatgatctccaagaatgttatgtatgaaatactagataagtttatg
aatgttgccatttcagatactgaataggatatcaggtaaacaatgcttgcatctctaaat
gagaattttgatccatatttaaattcgcctaataatttgagaaaattatttttatgcatg
aatgatccgatctcagaagtttaagaaattgctttaactattctttgtcgtttatccatt
ttgaatccctcagaaatcatcccctttcttaagaagacactatttgaatacctataaacg
ctgacatttgacagcaatcaaccagaaaaacaaaccatcaataagttatacttattgaca
tcgctaatcaaacatggccgtactattgtccaaccctacaccagcaatatagcaaaggtc
attcaataacatctaaagaaccccaacactaatgctattgtaacttcatatttgttaaag
gcgtttgctcaattaactgaaacggcaaatcaagagatacttgttaatttaaaagaagtc
tttgatatcattataacagcaatgcaagataagagttctactcttaaaagagaagctgcc
gtcaaatctctaaatttaattataaaaaatacagggtttgttgtactcccttattatcgt
tttcccaatctaatggatgtcatattctagttaattagaactgaaactatccctgaaatg
cgataagaatgtttgaaattactaggcaatcttggagctgtagattcattcatttacaaa
agtgtttagggagtgccaaccaaataaaaattcaagtttctaaaaaattatcaaaatgct
ctcaattctgtttcatcaagtgaattaatgaatgaagtcagaggatatagtgaggatttg
atacttataggtaatttcagttctaaaatgttcttacatcttggaaaattgaaaatgcaa
actgatcaagatactttactctattaaaataataatgctttgataacgaaatcagtaaca
ttggatactcaatctcattatcattaagctataaactcataggatattgaagaactgttt
caacaagttcctgtcatataactaaatgacattgattattattcaaaagtgaccctaaag
acgctattataaattctgttggatccatctttatccaataatcatgaattagcactcgaa
accattatgtggatcataggaaccttaaaagcaaagactgcaagttatttgaactatcta
ataccagtttttgctcgtttgttgtaaaggaatgaagaaatgaaagagaaagtattgaca
tctttgtaaaaagtaatccatttgtgtggaatataattcaatcctcaatacattgattaa
gtgattgcttgtgtaatgctattttgttagggataagagtcatcaaagttagttttgata
ggtttagagattatggagacattgattaaaagtagtaaaccacacttgagacataaagtg
gaaccattagttagactaatcaattaggaaatcagtcaatttgaagaggaaaaagatcta
gttcgtaaaggcataaagatatacatattgttagagaatttacttgactgctaattgcac
atgtttatcccatttatgtgcaagttgttaagtaaagaggtttccagtgttttattggag
gttagaaaggatataataaacttatttgtttctttatcaagaaaatgcccaactacagtt
caatatttgtcattgattgtgaactcactgttaaatctagtggaattgagtgcaaagaca
caacagcaattagaaatgcatcagacagtgttaaattgcattgttaacctaatcttataa
cataagaatcttatgcttgtgtatttaccaatgatccatttgcaagtgtagaaatacaag
atacatcatcaataatattagaaattagtagaaatctttttgatgtatggtaatttggaa
gacttgaacaatctattagatgaggattgcaaagctattgaacaattatttccatcttag
attacgtaatattattcaatcgaaccaaatgcaccaatgtacaagaagatagaacctgaa
gaattggtggctaaatttgacacagaataaagaaatctgaaggaagaatggcaagagtgg
atgcgtaatacaagtgtggaattattgaagttatcaccatttctggtattgagtccctgt
tcatctattgctgagatgtattagacattggcatatgaattattcaatattgcatttgat
tcagcttggtatttcttgaatgataagcacaaagaattaatggtccaatacttggtcaga
gtaattaaggctgacaacattcccctctaaatctcatagacaatactaaatctggcagaa
tttatgtagcatgataaggaaggattgcaaattgacattagttctttaggagaattggct
gaaaaatgtatggcttatgctaaggctctctattatcgagaacacgaatttgagactgcc
aattcaaaagccatacaatctctcatatctctttatacaaatttgggactctaagaatct
gccaatggtttattgacctatgctaaatagtccctcaagatttaagtgtaaaatacagat
tatgagcgattaaagaaatgggatgaagccctacaagagtacagacaatagcaactgaag
tacgaaaatgattagagaatggacttagctattaaattggtggttcctaagatgagatgt
ttgaatgcattgatgtaatggtaaacattgattagtcaagcagaggagatatttaagagc
aatgaagatgctaaacaaaaggaaattgctcatttagctgcaaatgctgctatgcactta
gggcaatgggataaattggctacttataatgaataagtgaatgctgaggagtcagacaag
ccattttggaaggctgctgtttgcatttccaagggacaattggatgaagctaaaatacaa
gtaagaaagagcagagagagattggatggtttggttacaggattactacaggaatcatac
gatagagcttaagatggagtattaaaattgtaatagttagttgaaatggaggaaattata
gaaatcaagcaatttgaaaataaggtatagaaggcagcctaagagaatgtaggtgagtat
tcgtatattaaattattggatgaattagagattcgtaagaaaaagttaaaagatatatgg
catgatagattgagtggagcaccaaaagatattgatgtctggtaccgtttgctttccact
cgtcaattgtatttacctaaagtacatgatcttgacatttggattaaatttgcaaagtta
tgtttgaagagataaaaaatggtattatgcaaatctaccattgaaatactgaaagaatag
ttttagaattaaggtttggctccactgcctgtcactcttcacatttttaacatgtaattt
gaatatgtgcatgccaaacatgaaatctaaattctagattaggtgagagagtatttcacc
aattaggaatagataagttctattgattctaaattaaaggctaagacattttttactctt
ggaaaatgggcttatgaaagagctgaatcaacaagtgatttagaatagatcactaaataa
ttcgatgaatccttgcaatataattccacttatgctaaggcttggcattattatgggtta
tgcaatttcgaggttattgaataataagaaaatagataatctatgaatgcacatgtattt
gcagcagtcaaaggattcttgaaatctatatccctaggaagtagagatatcaagaaaggt
agatacattctataagatactttgcgtctattatccttgatatttaaatatggaatggaa
gctgctatatctgatgaatttagatagaattataaataaatagacgttattgcttggatt
gatgtcattccataaattctagccagaatccaaattcaaaatcccattatttaatagtta
ttacaagatctattaattcacatcagtcgaattcatccataagctcttatatatccattg
actgtggcttgtaaatccaaaaaccaaattaaaagactgtaagtacttaagatattggat
gatatgaaaaagcattctccaattcttgttaacgaagctttaatcattagtgaggaactc
aatcgtactgccattttattgaaagaagcatggagagaaggaatccaagaggcatggaca
tcattttcttaagacaagaataaaacacatgttgaaagaattttaagaggattacatgat
aatatgagagttaaacttgagagtttgagtgagatctcatttcatcaaacatatggataa
gagatatttgaggctgaagcatggttatagaggtatttaagaactgaagattaagtatgt
ttatgcgttgcttttgatatctataccagaatctatcataaagtttagaagagcttagaa
aaaatgaagaaagttcatcttgaaaatgtatcaccaaaattgctggctacttaaaattgt
gaaatcagtattcctggattgtataaaacaaataaataacttattacaattaatggattt
gctcctagattagatgttctatcaagtaagtagcatccaagataggttaagatatttgga
aatgattcaaaagagtactagtttttattaaaaggacatgaggacttaaggtaagatgaa
agagtgatgcaattattttcattagtaaatcgattactcacaaatgatactgaaacagag
aggaaagatcttacaattacaagatattctgttatacctttatctcataatactggatta
ttaggatgggtatagaattgtgatactttgcaacaattagtaagggagtatagagataaa
tatgcaatcagatctaatgcagaaagcactttaatggaataattttgtgctcaatatcaa
aatctgcctttgcctaataaagttgagatttatagacacattttagaaaatactagaggg
gaagatttgcaaaaggtgttgtggataaaatcaccaaattctgaagtttggcttgaaaga
agaattaattatacaagatctttggctacaatgtcaatgggagacagacatccatcgaat
tttatgttgtaaagattaactggcaaaattgtacatatagattttggagattgttttgag
gtggcaatgaaaagagagaaatatccagagagagtccctttcagacttacgagaatgttg
gtaaaagcaatggaggcttgtggaatagaaggagtatatagacatacatgtaatattgta
atgagagtactaagggaaaataaggaatctctattggctgtgttagattcgtttgtgtat
gatcctttacttacatggagacttttgaatgcataagatcataaacctaaaaaggaggct
aggaatgtagatttacacaagtaaatcccacattaggggaagagtttgattcaggtcatt
ccagaagctaaaaggaggggcagcataattgatgacggaaagcagtagtaaactctgaag
agaaaggagagtggaagggagaaggaaatatattttgaatttgctgatgaagagagggaa
atcccagatgatttataaaattagaaggggttagaggttattgagagaatcaagaaaaaa
ttacaaggaagagatttcaaggaacatgaggtgttgtcaactgaaagtcaagtcaatcaa
ctcatactataagcaactaatcatgaaaatattgcacaagcttacttgggatggtgtcca
ttttggtga

DBGET integrated database retrieval system