KEGG   Paramecium tetraurelia: GSPATT00027717001Help
Entry
GSPATT00027717001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     GSPATT00027717001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 659 aa AA seqDB search
MEFQYILLAPVVLLVGIIIYFLKSKSESKQNQQPQQVISGEEKKIQCQDQLIPISIYFGS
QQGTAARFAKQLSEEGKEHGFITTEIDLNEVEFENEMKKGKVGIFCMATHGEGDPTDNAK
KFISWLQEPQPSLVGFQFAVFGLGNRQYEHYNKIGKLTNNLLEGQKGVRCYQYGEGDANS
TLEDDFIDWKKDLWNELKISLKDLIDQAKNCQVQQEVQENPESTNDNTNTGSTFKLVVSN
SEEINFDQALQGQYDFQTKQFLKAKYCQVVSISQLRQNQKDGSTLQIIFDTGREGIEYKT
AMNLGVYPENDDQQILEIANYLGENLDTVYSLELLQQNNRAKVPFPSPLSVRKILKHFVD
FNGQLMKNTLTKLSKISSNDEKLKNQLIQLTTEEGKAGFQNLVDNMKTTIYQLIKENNIK
LNLAQFIELCPRISPRLFTIASSNLKNPQHVEIADSLLIDTLPNGTEKLGLCSQYFINVQ
KKLLEGECVRVRVDFRESSFKLPDDPNKSIIMVGPGTGIAPFIGFLQEREIFLQSQPQRQ
NEYILYFGCKHQDGDFIYKDQLREFERSKTIDRFYTAFSRDQEQKCYVQDLLKRNSEELY
NQILNDKVVIYICGSTSMGNSVQNLIKEILSTNGNWTEHEAEEKIQSMEKQKLLIKELW
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggaatttcaatatattttattagcacctgtggttttgctagtgggaatcataatatat
tttttgaagtctaaatcagaatctaaatagaaccaacaaccttaataagttatcagtggt
gaagaaaagaaaattcaatgtcaagatcaattaattccaatctcaatttattttggatct
caataaggcacagcagctcgatttgccaaataattatctgaagaaggaaaagaacatgga
tttattacaacagagatagatctcaatgaagtagaatttgagaatgagatgaaaaaggga
aaagttggaatcttttgcatggctactcatggggagggagatcctacagacaatgcaaaa
aaattcataagctggttataagagccttaaccatcattagttggatttcaatttgctgtt
tttggacttggcaatagacaatacgaacattacaataaaattggaaaacttactaacaat
cttttggaaggctaaaaaggtgtgagatgctactagtatggtgaaggagatgccaacagt
acattagaagatgacttcatagattggaaaaaagacttgtggaatgaattgaagatttct
ttaaaggatttaattgattaagcaaaaaattgctaagtttaataagaagttcaagaaaat
cctgaaagtactaacgacaacacaaacactggatcaacattcaaacttgtggttagtaat
agtgaagagattaattttgattaagctctgcaaggataatacgattttcaaactaaatag
tttttaaaagcaaaatattgccaagttgtttcaatttcttaattaaggtaaaatcaaaag
gatggttcaacacttcaaatcatattcgatacaggtagagaaggaatcgaatataaaaca
gcaatgaatttaggagtttatcctgaaaatgatgatcaacaaattctcgagattgcaaat
tatttaggagaaaatcttgacactgtttatagtttggaattactataatagaataataga
gcaaaggttccttttccttctcctttaagtgtgagaaagattttgaagcactttgtggat
tttaatggttagttaatgaaaaacacattaacaaaattgtcaaagatttcaagtaatgat
gaaaaattaaagaactaattaatccaattaacaacagaggaaggaaaagcaggcttctag
aacttagttgataatatgaaaactacaatctactaattgattaaagaaaacaatatcaaa
ttaaatttagcatagtttatcgaactttgtccaagaattagcccaagattattcacaata
gcatcatcaaacttaaaaaatccttaacatgttgaaattgctgatagcttattaattgat
acactaccaaatggaactgaaaaattaggtttatgttcatagtatttcataaatgtccaa
aagaaactcttagaaggggaatgcgttagagttagagttgatttcagagaatcaagtttc
aaattaccagatgatccaaataaatccataattatggtaggaccaggaactggaatagct
ccatttattgggtttttataagaaagagaaatctttttataaagtcaacctcaaagacaa
aatgaatatattctatacttcggatgtaaacaccaagatggagatttcatttataaagat
taactaagagagtttgaaagatcaaaaaccattgatagattttatacagcattctcaagg
gatcaggaatagaaatgttatgtgtaagatttgcttaaacgcaactctgaagagttatat
aattagatattaaatgataaggttgtcatttatatatgcggatcgacaagcatgggaaat
tcggtttaaaatttgattaaagagatactaagtacaaatggtaattggacagaacatgaa
gctgaagaaaagatataaagtatggagaaataaaaattactcatcaaagaactatggtga

DBGET integrated database retrieval system