KEGG   Paramecium tetraurelia: GSPATT00027724001Help
Entry
GSPATT00027724001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ptm  Paramecium tetraurelia
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    GSPATT00027724001
Messenger RNA biogenesis [BR:ptm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     GSPATT00027724001
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     GSPATT00027724001
Translation factors [BR:ptm03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    GSPATT00027724001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 205 aa AA seqDB search
MSDQFHQLSDKWTISEKYTQNKDDDYKKTIAEICSIRSVEEFAFIMKQTIYQSLTDLFSE
PQQQKQFKNFKNNAIETQIEAIQFFKNGISPLWEDPENEKGGDIQFEVPIALIGIYNQLY
TEIIHEIIGQQKEELRHVNGVRVLDKINAPKGNGIRIELWLDIDPTDKNEEVQIQIKKID
DWILQLAELFDIRQLKLKTQSHKKK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactaatttcattaactgagtgataaatggaccatctctgagaagtatacctaa
aataaagatgacgattacaaaaagacaatagctgaaatatgctcgatcagaagtgttgag
gaatttgcatttatcatgaaataaacaatctattagagtttaacagatttattcagcgag
ccataataataaaaataattcaaaaattttaagaacaatgctatagagactcaaattgaa
gcgatctaatttttcaaaaatggtattagccctttgtgggaagatcctgaaaacgaaaaa
ggaggtgacatacaatttgaggttcctattgccttaattggcatttacaatcaactctac
actgaaataatacatgagattatagggtaacaaaaggaggagctaaggcatgttaatgga
gtgagagttctagataaaataaatgcccccaagggtaatggaatcagaatagaattgtgg
ttggatattgatcctacggataaaaacgaggaggtataaatccagattaaaaaaattgat
gattggattcttcaattagcagaattatttgatattagataacttaaattaaaaacttaa
tcacacaagaaaaaatga

DBGET integrated database retrieval system