KEGG   Paramecium tetraurelia: GSPATT00028688001Help
Entry
GSPATT00028688001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K05759  profilin
Organism
ptm  Paramecium tetraurelia
Brite
Membrane trafficking [BR:ptm04131]
 Others
  Actin-binding proteins
   Others
    GSPATT00028688001
Cytoskeleton proteins [BR:ptm04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     GSPATT00028688001
Exosome [BR:ptm04147]
 Exosomal proteins
  Proteins found in most exosomes
   GSPATT00028688001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin DUF3290 NusG_II
Motif
Other DBs
NCBI-GeneID: 5010835
NCBI-ProteinID: XP_001425051
Genoscope: GSPATT00028688001
UniProt: A0BGI6
Position
undetermined
AA seq 156 aa AA seqDB search
MSWDAYVTNLTANGALEYAAIIGLDGNIWASNFGVAVLPSYQAEVPDEKNPDVVTKVAYD
EKTAFVHALTHNGNSGNAAGVRVNNQKYYTIQFDNDAKSWYLKKNKGGACIAWSNTAAVF
ASFSQTINAENGATQNAAECNKRVIEMAKYLADSGY
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggatgcttatgtgacaaatttgacagccaacggagctcttgaatatgctgcc
attattggattagatggaaatatctgggctagcaattttggtgttgccgtcctaccttct
tatcaagctgaagtcccagatgaaaagaatccagacgtcgtaaccaaggttgcctatgac
gagaagactgcctttgttcacgctctcacacacaatggaaactctggaaatgcagctgga
gttagagtcaacaatcaaaaatattatacaattcaatttgataatgatgctaagtcatgg
tatttgaagaagaacaaaggaggagcatgcattgcttggtctaacaccgccgctgtcttt
gcttcattctcctaaaccatcaatgcagaaaatggagctacttagaatgctgctgaatgc
aacaaacgtgtcattgaaatggcaaagtacctagctgattctggatattga

DBGET integrated database retrieval system