KEGG   Paramecium tetraurelia: GSPATT00028925001Help
Entry
GSPATT00028925001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ptm  Paramecium tetraurelia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSPATT00028925001
   01230 Biosynthesis of amino acids
    GSPATT00028925001
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSPATT00028925001
   00051 Fructose and mannose metabolism
    GSPATT00028925001
   00562 Inositol phosphate metabolism
    GSPATT00028925001
Enzymes [BR:ptm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GSPATT00028925001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GSPATT00028925001
  Exosomal proteins of bladder cancer cells
   GSPATT00028925001
  Exosomal proteins of melanoma cells
   GSPATT00028925001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 253 aa AA seqDB search
MRRYFVGGNWKCNNTIAQTQSLINTVINKLVFDINKVEVVVAPISLHVPWVQANIQKNVQ
VSIQNSSSTKMGAYTGEISVEQVKDLGIPWVILGHSERRQYNGETNEIVGKKTRIALDYQ
LNVIACVGEKQAERESGQTTQVIQAQLESIKKELTIEQWAKVVVAYEPVWAIGTGQTASP
EQAQEVHAFIRAWLKSQIGTQAEQATRIIYGGSVTEKNAADLIKQPDVDGFLVGGAALKP
AFADIVAAANNSR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatactttgtaggtggtaattggaaatgcaataataccatagctcaaacttag
agtttgatcaatacagtcatcaacaaactagtatttgatataaataaagttgaggttgtt
gttgctccgatatccttacatgttccatgggttcaagctaatatctaaaagaatgtgcaa
gtgtctatttaaaactcatcatcgactaagatgggtgcctatactggagaaatcagtgtt
gagcaagtcaaagatcttggaattccttgggttattttggggcattctgaaagaagataa
tacaacggagaaaccaatgaaattgttggaaaaaagactagaatagctttggattaccaa
ttaaatgttatagcatgcgtaggtgaaaaataggcagaaagagaatctggatagacaacc
caagttatctaagcataattagaatcaatcaaaaaggaattgacaattgaataatgggct
aaagttgtagttgcatatgagccagtctgggcaattggaacaggataaacagcatctcca
gaataagctcaagaagtccatgctttcatcagagcttggcttaaatcttagattggaaca
caagctgaataagctaccagaattatttatgggggatcagtcacagaaaagaatgctgct
gatttaattaaataaccagatgttgatggatttttagtcggaggtgcggccctaaagcca
gcctttgcagacatagttgctgctgctaacaatagtagatga

DBGET integrated database retrieval system