KEGG   Paramecium tetraurelia: GSPATT00030070001Help
Entry
GSPATT00030070001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ptm  Paramecium tetraurelia
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ptm00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ptm04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 705 aa AA seqDB search
MNKINHQGVNSLVYGVLLNVKLHKMKRTQIILLLSPNEVRMIQMLDPQGTFSTYFDLTQI
SDIQQKEQSKLKIINIQGEYIKLYFENPFQLITIKEGLDYLIKEGNRIQKQLDSYNQIWS
SALKLITKADIDMDNKLNFKEFQFLIGELQIEIPERKLIQIFEKNQKNNQLDEATLYKLL
MDITRRHELTELYQKYSSKQEGMFEDPLQAMLMTDKDLQQFFKVEQAQNDYQPKRKQYNF
YDFQNLIFSEENSLFQPTAVDLSQPITKYLINSSHNTYLETNQLTGESSCFAYQDAFKMG
FKCVELDCWDGEDGEPKVTHGHTLVNDIKFKDVISTVRDFAFYKDNNPAILSLEMHCCLK
QQKRIADLLQSILGEMLFVVKDFKQEKFSTLQQLQRRVLVKYKGDDQFLQEKLQTQSSTL
FYTQSHDDMLITFDDDDNQDIQANVKQFSQTLDEHHKKICRELLEITSLYAVSLKLDKKP
ELVWIVSSVSEDKIQDVIKKSHGKFQEYVDNYFVRVYPLGLRFDSSNYDPFPSWTAGAQL
VALNIQTKDLFMLQNYGMFLNSSYVLKSNQDVRMNIYVRIISATNLVWEEAKRRQEEIVD
PYIKIRVAGNKDDVNKSDKWRTEVVQDNGYHPIFNYQCVIQLKHAQQDVIYVQAYSYSIL
GDSLLGQYCLSPLNLRTGYRIIPLLNSQFKTLANSYVLVQIKIEY
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcaaccattaaggtgttaattcattagtttatggtgtgctactcaacgta
aaattgcacaagatgaaacgtacttaaattattttattgttaagtccaaatgaggttcga
atgatctaaatgcttgatccccaaggcacttttagtacctatttcgatctcactcagatc
tcagacatctaataaaaggaataatccaaactaaaaatcatcaacatttaaggagaatac
ataaaactgtatttcgaaaatcctttccaattgatcacaatcaaagagggattggattat
ttgattaaggaaggcaacaggatctaaaaacaacttgatagttataatcaaatctggagc
agtgctctcaaattgatcaccaaagcagacattgacatggacaacaaactcaacttcaag
gaatttcaattcctaataggagaattgcaaattgaaattccagaaagaaaactaatttag
atcttcgagaaaaatcaaaagaataatcaattagacgaagcaaccttatataaattatta
atggacataacacgcagacatgaactaacagaattataccaaaaatacagtagtaaacaa
gaaggaatgtttgaagatccactctaagccatgttaatgacagataaagacttacaacag
tttttcaaagtcgaacaagcttaaaatgattattaacccaaaagaaaataatacaacttt
tatgatttccaaaatctcatctttagtgaggagaactcactatttcaaccgacggctgta
gatctatcttagccaatcaccaaatacttaattaattcctcacataatacttatttggaa
acaaattaattgacaggcgaatcaagctgttttgcttattaagatgccttcaaaatggga
tttaaatgtgttgaattggattgttgggatggtgaagatggagaacccaaggttactcat
ggacataccttggttaatgacatcaaattcaaagatgtcatctctacagtaagggacttt
gccttctataaggataataatcctgccattttatcacttgaaatgcattgttgtttgaaa
taataaaagagaatagcagatctcttataaagcattcttggagaaatgctgtttgtggtt
aaagatttcaaataagagaagttttctacattacaataattgtaacggagagttctagtt
aaatataagggagatgatcaatttttataggagaaattgcagactcaatcttccacatta
ttctatacacaatcacatgacgatatgttgattacatttgatgacgatgataattaggat
atctaagctaatgttaaacaatttagtcaaacacttgatgaacatcacaagaaaatatgt
agagagttattagaaattacttcattatatgcagtatcactaaaattagacaaaaagcca
gaattagtttggattgtatctagtgtttcagaagataaaatataggatgtaataaagaag
agtcatggcaaattctaagaatatgttgataattattttgtcagagtctatcctttagga
ttgagatttgattcaagcaattatgatccattcccatcttggactgcaggagctcagttg
gttgctttgaatattcagaccaaagatttatttatgttgtagaattacggaatgttcctt
aacagttcctatgttttgaaatctaatcaagatgtacgaatgaacatttatgttcgcatc
atcagtgcaactaatctggtttgggaggaagcgaaacgtagataagaagaaattgttgat
ccatacattaaaattagagttgctggaaataaagatgacgtcaacaaatcggataagtgg
agaacagaagttgtttaggataacggatatcatccaatctttaattactaatgtgttatc
caactaaaacatgcttaacaagatgttatctatgtataagcctacagttattccatattg
ggagattccttgttgggctagtattgtttatcaccacttaacctaaggacaggctataga
ataattcctttattaaattctcagtttaaaactttagctaattcctacgttttagtgcaa
atcaaaattgaatattga

DBGET integrated database retrieval system