KEGG   Paramecium tetraurelia: GSPATT00030321001Help
Entry
GSPATT00030321001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ptm  Paramecium tetraurelia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GSPATT00030321001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     GSPATT00030321001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 761 aa AA seqDB search
MPPFKQPKKQVTSIEKPVVEEQRPSTAYQVVYSRDIRKKKKQMFDGVLVIENQRMKLFDM
ESKQLFAGSDQIYDNISQYYMGQFYVELMNQIPIDEFKSGKIFMAQPEPEQKVIVKPKKP
FKSKQQPDVEPKFTILEGFDVDQFLYKQLRAHQIEGVRFMLECVTGKKGKSIRGCILADS
MGLGKTLQAITLMWILIQSHEISKIVITCPVSLIGNWEKEIKKWLGPMRLQPLSAIGTKD
EVNKQVKYFLYSPYNLLLTSYETFRNICNEIDKVIDLLICDEGHRLKNSNIKTVQAMNQL
KCKRRIVLSGTPIQNNMKEFYACCDFVNPGIFSSYKTFKLVFQDPIEMSMEKGSSAETVE
LGKLRSQELSSLTSQFILRRKPEILSKFLPSKFEYLIFCTMTPQQQVLYKRSLQLCPNSV
MMQLNLLRKVTTHPKLIEDDESQAAEKLVVQDYQSVKFNCLKILVDQCKEQNEKVVINSY
YRQTLDQIEHNLIQWNLKFLRLDGKVVQKQRLTLVDEFNKDKDITVFLLNGKSGGTGLNL
VGANKMICVEVDWNPANDSQVMGRIWRDGQQKQVHIYRLITCGTYEEKIMQRQLTKENLS
QNIVDEKSLQNQFTTEELKDLLTYKDSQKCYIFDQSDKLEAEHDYPTDLNKFVVLVKIHK
TQSCIPNEFDNQNTFLEKVIEDPQNIQYLDNDENPESEGDNSQQEQQEQEQQQEPQEQEV
FKDITNQFQNVNLQEQQEKNDQQQADFPLANINICDLSFLD
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgccgccattcaaataacccaaaaagcaagtcacttcaattgagaaacctgtagttgaa
gaacagagaccttccactgcctattaggttgtatattcaagagacatccgaaagaagaag
aagtaaatgtttgatggagttttggtaattgagaattaaagaatgaaattatttgatatg
gaatctaaataattgtttgcaggcagtgatcaaatttatgacaatatttcacaatattat
atgggataattctatgttgaactcatgaatcaaatacctatcgatgaattcaaatctggc
aaaattttcatggcttaaccagaaccagaatagaaggttatagttaaacccaagaaaccc
ttcaaatctaagtaatagccagatgttgagcctaaatttactattttggaaggttttgat
gttgattaatttctctataaataattgagagcacatcaaattgagggtgttagattcatg
ttggagtgtgtaacaggcaaaaaagggaaatccataagaggatgcattttagcagatagt
atggggttgggaaaaacattgtaagcaattacattaatgtggattttgatataatcacat
gagatatccaaaatagttatcacttgtccagtttcattgattggtaattgggagaaggag
ataaaaaaatggctgggtccaatgagattgcaaccattatctgccattggcactaaagat
gaagtaaataagtaagtcaaatattttttatattctccatataatctattattgacttca
tatgaaaccttcagaaatatttgtaatgaaattgataaggttattgatttactaatttgt
gatgaagggcatcgattgaaaaatagtaatattaaaacagttcaagccatgaattaattg
aagtgtaaaagaagaatagtcctaagcggaactccaatctaaaacaacatgaaggagttt
tatgcatgttgtgatttcgtcaaccccggaatattctcgtcttataagacttttaagttg
gtcttctaagatccaatagaaatgtctatggaaaagggatcaagtgctgaaaccgttgaa
ttgggcaaattaagatcttaagaattaagttcattaacaagttaatttattttgagaagg
aaacctgaaattttgagcaaatttttacctagcaagtttgaatatttgatattttgcaca
atgactccataataataagtgttatataagagaagtttgcaattgtgtccaaattctgtt
atgatgtaattaaatttattgagaaaagtcactacccatcctaaacttattgaagatgat
gaaagtcaagctgcagaaaaattggtagttcaagattattaatctgttaagttcaattgt
ttaaaaatactagttgatcaatgtaaagaacaaaatgaaaaagtagtaatcaatagttat
tatcgataaactttggattagattgaacacaatctcatttaatggaatttgaaattcttg
cgattagatggaaaagtagtgtaaaaacaaagacttactttggttgacgaatttaataag
gataaagatattactgtatttttattgaatggaaaatcaggaggcactggattaaattta
gtgggagcaaataaaatgatatgtgttgaagttgattggaatcctgcaaatgattcttaa
gttatgggtagaatctggagagatggttaataaaaataagttcatatttatcgattaata
acatgtggaacctatgaagaaaaaattatgcaaagacaattaactaaagaaaatttatcc
taaaacatcgttgacgaaaaatcattataaaactaatttactactgaagaactcaaagat
ttactgacatataaggatagccaaaaatgttatatttttgatcaatcagacaaattagaa
gcagaacatgattatcctactgatttaaataaatttgttgtattagttaaaattcataaa
acctaatcttgtattccaaatgaatttgataattaaaacacatttttagagaaagtgatt
gaggatccctaaaatatctaatatctagataatgatgaaaatccagaatctgaaggtgat
aattcatagtaagaataataagaataagaataataataagagcctcaagaataagaagta
ttcaaagatataaccaatcaatttcaaaatgttaatttgcaggaacaacaagagaaaaat
gactaataataggcagattttcctttagctaatataaatatttgtgatttatctttttta
gattga

DBGET integrated database retrieval system