KEGG   Paramecium tetraurelia: GSPATT00030472001Help
Entry
GSPATT00030472001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     GSPATT00030472001
Peptidases [BR:ptm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GSPATT00030472001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 1041 aa AA seqDB search
MKFPRNDNDHEDSDDQQITGISQFQANKLKQQAKEMNQMLLQLQENFEDEDCDKYYILSK
NWFDQWKQHVSYDQVVNGQAPDKKFGQTMLQNYNNELLEMRINECFKYYPLNSNPWNIWL
KPNLQEDKDYIVISQQIQNYLNQNYRGPQIVRNSVGQGKDKKVVVNLFKFNAALILPNTI
IQIAQDNLTQFEKEYLQADENCVLKDFYALIQKTVHTFRGNYNNQNGVRIWRYKNQNDPH
KALFAEIRKQVQDLDFNDDQVFDFSGDPIENSADITLKSLKLTDNDLVVIEFQQSFKPWC
IRHPSVPIEGKCESCGSISELHFPCKCKKVAYCSEKCKVNDERYHLPKCDPCGSDDEQVK
NMNISEQSVKGVAGLGNLGNTCFMNSGTQCLSNTYQLSEYFITNKYFDEINEDNPLGTNG
QLVRKYASLIKKLWCGDKNIVIPTSFKKAVGQFQPMFKGFQQHDSSELITFLLDGLHEDL
NRVKKKPYVESKDNQGKPDFEVAKESWQNHLARNQSIIVDLMHGQYKSTLKCPTCSQISI
TFDPFLTCGLSIPSKKLKSIQIKAIKSIVQIETKYINFEGSKKTMPLHEFTKEQIIPEFK
IDPNQELIYYTSYSNDIQDLIDPKSEINSVRKNSKRGYLVVKPLSEEEKAIPLDDRIYLS
YSQKALDGFGQQYKRTILQQFYVIIEKEHTLKQIHLAIFKALLPIFCDLVSITDLQTPEQ
LKQYYEDNIYQKYYTIQFKSPSTYWQSCSFCNLKNCSDCDADYIDETYQKIKNKAQQNDL
YTKIELIVFWNKSPFQNVKPVDIYQYYQNQQNKKQMEEERNSTNNNDENSNNNLNKPRYM
AKSNNYSNNNAIQKVTLQECLKQSEQPEQLAEDNAWYCKICKEHVQAFKSMQIYKASDIL
IFTLKRFKASSGFFKQKLETFVDFPVKGLDLTEFILNKNRPLDYDKETQQKEMIEEEFPE
KRDDHKKLIYDLFAVSNHFGGMGGGHYTAFGKNHLNGKWYNFDDAQVNEVDEDQIITKSA
YVLFYKRRSKEEITQDFNTQD
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcctagaaatgacaatgatcatgaggattcagatgactaatagataacaggg
atttcccaattttaagcgaataaattgaaacaataagcaaaggaaatgaactagatgttg
ttgtaattgtaggagaactttgaagatgaagactgtgacaaatactatattttgagcaaa
aattggtttgattaatggaaatagcatgtgtcatatgattaagttgtaaatggtcaagca
cctgacaagaaattcggataaacaatgttgcaaaattataataatgaattgctagaaatg
cgcataaatgaatgtttcaaatattatccgcttaactccaacccttggaatatatggttg
aaacccaatttacaagaggataaggattacattgtgatttcataataaatctagaactat
ctgaattaaaattacagaggtccttagattgtgcgaaattcggtaggacaaggcaaagat
aaaaaggtggttgtgaatttgtttaagttcaatgccgcattgattttacctaatacgatt
atttaaatcgcttaggataatctgacataattcgaaaaggaatatttataagcagatgag
aattgtgtattgaaggacttttatgctttaatataaaaaactgtgcatacttttaggggt
aattacaataatcagaatggtgttagaatttggagatacaaaaattaaaatgatcctcat
aaggcattgtttgcagaaatcagaaagcaggtttaggatcttgatttcaatgatgatcaa
gtctttgatttttctggagatcctattgagaattcagcagacatcacattaaaatcatta
aaacttactgataatgaccttgttgtaattgaattttaacaaagttttaagccctggtgt
attagacatccctctgtgccaatagaaggtaaatgtgaaagttgtggttcaatcagtgaa
cttcattttccatgtaaatgcaaaaaggtagcttattgttcagaaaaatgtaaagtgaat
gacgaacgatatcatcttccaaaatgtgatccatgtggatctgatgatgaataagtaaaa
aacatgaatatcagtgaacaatctgtaaaaggagtggctggattgggtaatctaggcaac
acatgttttatgaacagtggtactcaatgcttatctaatacatatcaattgtccgaatat
tttattactaataaatattttgatgagattaatgaggacaatcctctaggaactaatgga
taactagtcagaaagtatgcctcccttatcaagaaattatggtgtggtgacaaaaacata
gtaatcccaactagtttcaaaaaagcagttggataattctaacctatgttcaaaggattt
taataacatgattcttctgaattaattacttttctattggatggattacacgaggatctt
aatagagtcaaaaagaaaccttatgttgaatcaaaggacaaccaagggaaaccagatttt
gaagtggcaaaggaaagttggtagaatcatcttgctagaaatcaatccattattgttgac
ttaatgcatggacaatataagtcaactcttaaatgtcccacatgttcttaaatttctatt
acttttgatcctttcttgacttgtggacttagtattcctagtaaaaaattaaagtccatc
taaatcaaggcaatcaaatcaatagttcaaatcgaaactaaatatatcaactttgaagga
tccaaaaaaacaatgcccctacatgaattcactaaggaatagattattcctgaatttaaa
atcgatccaaactaagaattaatctattatacttcgtattccaatgatattcaagatcta
attgatccaaagtctgagattaattccgttagaaagaattcaaagagagggtatctagtg
gtcaagcccttgagtgaagaggagaaggcaatacctttagatgacagaatctatttgagc
tattcttagaaagccttagatggattcggctagtaatataaaagaactattctttaataa
ttctatgtaatcatagagaaagaacatactcttaaataaatacatcttgccatttttaag
gccttactacccatattttgtgatttggtttcaattactgatttgcaaactcctgaacaa
ttgaaatagtactatgaggataacatatactaaaaatattacaccatacaattcaaatct
ccaagcacttattggtaatcttgcagtttctgtaacttgaagaattgttcagattgtgat
gcagattacatagatgaaacctatcaaaaaattaaaaataaggcacagtagaacgatctc
tatactaaaatagaattgattgtgttttggaataagagtcctttttagaatgttaaacca
gttgacatctactaatattattagaattagcaaaataaaaaacagatggaagaggagagg
aattctacgaataataatgatgaaaatagcaataataatctaaataagccaagatatatg
gccaaatctaataattattcgaataataatgcaatccaaaaggttacactttaggaatgc
ttgaaacaatcagaatagccagaataattggctgaagataatgcatggtattgtaagatt
tgcaaagaacatgtccaggctttcaagagtatgtagatctataaggcatctgatattttg
atattcacattgaagcgattcaaagcatcaagtggatttttcaaatagaaacttgagacc
tttgtggacttccctgtcaaaggtttagatttaaccgaattcattctgaataagaatcga
ccattggattatgataaagaaacgcagcagaaggaaatgatagaagaggaatttccagag
aaaagagacgaccataagaaactcatatatgatttatttgcagtatcaaatcattttgga
ggcatgggaggaggacattacactgcttttggaaagaaccacttgaatggaaaatggtac
aattttgatgacgctcaggtgaatgaagtggatgaagattaaattataacaaagagtgca
tatgtgttgttttacaaacgtcgatcaaaagaggaaatcacacaagacttcaacacataa
gattga

DBGET integrated database retrieval system