KEGG   Paramecium tetraurelia: GSPATT00031174001Help
Entry
GSPATT00031174001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     GSPATT00031174001
Peptidases [BR:ptm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GSPATT00031174001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 2223 aa AA seqDB search
MFADLIQHIKNTSPQFVIGQYADAYDNYSSWRMCKVINLSTDSVTVQYDGWSQKYDETHK
LKVGRVVYFRSHTELYTGAQKSASREFQITKEVDHIQQVIEKMQKLIVSNFANVEAHDVC
QFVRGELYLLIDSVMQEQQCYTQGEFKMTTDLIEAFIRFFVEWANKILEKINIYIQGVQA
HPLIYYFHLDTCLVSCHPEMFDTLTKIFNGSGPRCKRYFQSNESQLLKMYSISDRHSQNV
QQGFFKYFQDQNGLQVIENLIAWQHSEGETKQKVPFGIIKNILPLVESIYKSFPTSQNRQ
EWLLKMKDMIINRLHKLTTNDLKESNLNPVFQIFKLIPQQFSSIINISQECEATEIKLAI
TLIKSSILEKKIKGVKELTEIIDKVTTSKNSMMYQSITSTYFNPDRLGKFLQEEKVFDIL
LQEAGHAEVFKRAAPILRFMVDQVNSSTKDIEQLWEASQMRHETEAQSVYEVISDIARVM
NHEQTEIIFTKLTNFSQKDIDLNLINFMKDFTQSAQKNPIWKNRAIYTLNMMWNLLQDKS
DLNPNLLEPLMTGFISCLKQEREQYQQLCLENLRKSYSFPQCLHILQKIIESYGQGQVYF
SVSSEDNLNKIMKEHQMIDLIVKNLENYKANVNTCQDCFAILTGKVAHAQRIQYKMDFLE
YIAASPKKYEFSLENFKKLWNILIINPIHETDRNPMLDFLVKGGFRVKEDLFKNIFCNIN
YPIKLCYRSIEKYFMQLNQKNGSINCQKSQIRIIKYDQIIGINFFFDVVFNYPDADQAIQ
TLLQLHMRTEKANQVDQKLQMWNSLLMKCKEALKQSNNSQVQVQNVIKCLKDLVTGIEGK
QYFNTSSPAITFTKFQVQLGKDEKTLKEVSLPSNSTLLAVRKNLNQLYNFNQQDYDMFLA
NHDMKINQDNEEDLTISLFEESKSRDKPDIILQNISQNMNSLCLSIRKFKATLSSNTELS
EILFDLLQSENYEDIWEVLTLMPQNKQIKDRLDRGGSDEESWSKILYFNCNKKLLYCLQI
YETMILQDKNVLQYFLKTKGCQSIINYYLKRQENEFTNLFNLKCFAQIAKIIGICSIKDQ
EINRKCVKYIIYSLQKIENKVYQDPSAIQSFLQYNFRIASTENVGDIEQMKKSLIELVDP
QIRKTLCQQLIDLKPLHKHFQNLGDNLQDVMKLKNQAEQYLELYAGVLEQTNNNDLTRIT
QRLPQILISFLQEEETEKILLQAFKLICILVTKCQESLLMITTDDQLADAIISSLFQLNG
KTLQSQDTRKAGYEIIQKLFANQKLMLIFEQYFSCAFWRTSSNTNWNIVQTQQSKSQTGF
VGLRNLGCICYMNSLMQQLFTLPNFRESILSLNLEQGQQTVAYQFQLLLSALKNSQKQFY
DPTNFCNVLGPNYKPINFYEQMDVDEFFLQLMDKLELELKPLKRDIIVPKSFGGFMSTEF
ISKGCQHQSSREELFLALSLQVKNKKNIYESMKMMTDGEMLEGDNAYMCEKCEKKVPALM
RVCIKQLPNVLIMVLKRFEFNYETQQKFKLNDYYEFPTQLNMKQFTKEYLQKQDFQDVED
ADRLIVTEYSDEYYDYHLRGVIIHVGTADHGHYYSLIKDAQTNKWYEFNDILVKPFEFGD
LATEAFGNDDKGRSNQLLSRSKNAYMLFYERKTYFDENGKPLKNDQELRWFFNNNKNEKQ
NDEILIDNIKFQISQVMFDESFFEFSCALLDEGSQIHIGRFCLQYFLTVVIRFQERGQFV
PRYLEKLKLITRNSVQLANEFLVSIQNVDVLNELILQNPIQDMRVIIGGLINDAIKCLMD
NEKFASYKEFKQKSNLIQLTQSMIHYIQNRKNSDQIQRIIYQLSLNDFSKTYLRELKFVG
RIFLYFLDEPPVGAGYIEIADPNVEQKLLKINKQYIRNEQQNPQILQQQENLKFDNLYID
YSYLVMALNQLIYQDDDELCMLDDPLLFKRLLSITFTRQARLALKEAIQKYIRLNNNPWD
QSLAVVQTLYEHMKDCDEKDLKTALIVLKGIGEIDDAYNEQRLTLVAEAYISALKDNLGY
WYYTSIMFDYVIKICTRLNFQKAFAEVLNRNKGVLKLMYQWLKESQNPFQNFSQQRWKVF
KKRQMNVLAQDITEKLNKFQALSQKRIESLEKIMSQQVVNSSGYDSDTVPNLEQQVDVII
PARTYLNNFETCGYSTWTIGINLGDMMELRQNNMIKWVFSTDSSLAPPNTQTLKYENHVS
FMK
NT seq 6672 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagacctcattcagcatataaaaaatacaagtccataatttgttatcggacaa
tatgcagacgcttatgataattatagcagttggcgtatgtgcaaagtgatcaatctctca
actgattcggtcacagttcaatacgatgggtggagctagaaatatgatgagactcataaa
cttaaagtaggaagggtcgtgtattttagatcacatactgaactctacacaggtgcttag
aagagtgcgtctcgagaattctaaataaccaaagaagtggatcacattcaataggtcatc
gagaaaatgcagaagttgatagtaagcaattttgccaatgtcgaagcacacgacgtctgt
caatttgtgagaggagaactctatctactaattgatagtgtcatgcaagaatagtaatgc
tacactcagggagaatttaaaatgactacagatctaatcgaggcctttatacgattcttc
gtcgaatgggcaaataagattttggagaaaatcaacatctatatccaaggcgtccaagca
caccccctaatttattattttcatttggacacctgtctagtatcctgtcatcccgagatg
ttcgataccctcaccaagatattcaacggaagcggacccagatgcaagcgttatttccag
agcaatgaatcccaactcttgaagatgtactctatctccgatcgacactcccagaatgtc
caacagggcttcttcaaatatttccaagattaaaatggcttataagtaatcgagaatttg
atagcttggcaacacagcgaaggagagaccaaataaaaagtgccttttggaataatcaag
aatatcctacccttggtggaaagtatctataagagtttccccacgagctaaaatagacaa
gaatggctactcaaaatgaaagacatgatcatcaatcgattacacaagttgacaactaat
gatcttaaggaatccaatctaaatcctgtcttccagatttttaagttgattccgtaacag
ttctcctccatcatcaacatctcctaagaatgtgaagccacagagatcaaattagccatc
accttaataaagtcatccattcttgagaagaaaatcaagggtgtcaaggaactcactgaa
ataattgacaaggtgacaacttccaagaactcaatgatgtatcagagtataacgagcacc
tatttcaatccggatagattgggcaaattccttcaagaagagaaagttttcgacattctt
ctccaagaagcaggacatgccgaagtctttaagagagcagcccctattctgagatttatg
gttgatcaagtgaattcaagcaccaaggatatcgaataactatgggaggcaagttagatg
agacatgaaacagaagctcagagtgtctacgaagtgatcagtgatattgccagagtgatg
aatcacgaataaacagagataatctttactaagttgacaaattttagttaaaaagacata
gatctgaatttgatcaatttcatgaaggatttcacttagagtgcctagaagaatccgatt
tggaaaaatagagccatctatacactcaacatgatgtggaatttactttaagacaaaagc
gatctcaaccctaatctccttgaacctctaatgactggattcatctcatgtctgaaatag
gaacgtgagtagtattaataactgtgtttggagaacttgaggaagagttattcattcccc
taatgtttgcacatcctataaaaaatcattgagagttatgggtaaggataggtctacttt
tcagtttcctcagaggataaccttaataaaatcatgaaagaacattaaatgattgatctg
attgttaagaaccttgaaaattataaagccaatgtaaatacttgttaagattgttttgct
attctgactggtaaagttgcacatgcttaacgaatacaatacaaaatggatttccttgag
tatatagctgcaagtcccaagaagtatgagttttcacttgaaaattttaagaaattatgg
aatatcctcataatcaatcctattcatgaaactgatcgcaatcccatgctagatttctta
gttaaaggaggattcagagtgaaagaggatttattcaaaaacatattctgcaacatcaat
tatccaatcaaattatgctataggagtatcgaaaagtactttatgcaattaaatcaaaaa
aatggctcaatcaattgctaaaagtcttaaatccgaatcataaagtacgatcagatcatt
ggtataaatttcttcttcgatgtggtcttcaattatccagatgcagattaagccatctag
actctgttataattgcacatgagaacagagaaagcaaattaagtggattagaaattgcaa
atgtggaactctctgcttatgaaatgcaaagaagctctgaaataatccaataacagttaa
gtgtaagtctaaaatgtgattaagtgtctcaaagatcttgtgactggaatcgaagggaaa
caatactttaatacgagtagtccagctatcactttcaccaagttctaagtctaattgggc
aaggatgaaaaaaccttaaaagaagtatctctcccttctaattccactttgttagcagtg
agaaaaaatttgaatcaactttacaatttcaatcaataagactacgatatgtttttggct
aatcatgatatgaagatcaatcaagacaatgaagaagatttgacaatcagtttgtttgag
gaatccaaatcgagagataagccagacatcattctgtagaatatcagtcagaatatgaat
tctttgtgtttgagcattcgtaaatttaaggctactttgagtagcaatacagaattatca
gagatattgtttgatttgttgtaatctgagaattatgaagacatatgggaagtattgaca
ttgatgccacaaaataagcaaataaaagatagattggatagaggaggttctgatgaggag
tcatggagcaagatcttgtacttcaattgcaataagaaattgttatattgcttgcaaata
tatgaaactatgatattataggataagaatgtattacaatattttttgaagactaaagga
tgtcagagtattatcaattattatctgaagagacaggagaatgaatttactaatctattc
aatttgaaatgttttgcacagattgctaaaattatagggatctgcagtattaaggattaa
gaaatcaataggaaatgtgtcaaatacatcatatattccttgtaaaaaatagaaaataaa
gtatactaagacccttctgcaattcagagttttctgtaatacaactttagaatagcctca
actgagaatgtgggcgacatagagtagatgaaaaaaagcttaatagaattggtagaccct
tagatcagaaagactttgtgccaataattgattgatttgaagccactccataagcatttc
taaaatttgggtgacaatttgtaagatgtcatgaaactgaaaaattaggctgaataatat
ttggaattgtacgctggagttttagaatagacaaacaataatgatttaacaaggattact
caaagattgccttaaatattgattagtttcttgtaagaggaggagactgagaagatactc
ctataggcattcaaattgatatgcattttggtgacaaaatgttaagaatcgttactaatg
ataacaacagatgattaattggctgatgcaataattagcagtctatttcaattaaatggg
aaaacactacaaagtcaggacacaagaaaagcagggtatgaaataatttaaaagttattc
gccaattagaaattgatgttgattttcgaacagtatttttcttgtgccttttggagaaca
agttcaaacacaaattggaatatcgtgtaaacataatagagtaagagtcaaactggtttc
gttggtttacgtaatctgggatgtatttgttatatgaattcattaatgcaataattattc
accttacctaatttcagggaaagcattctatccctgaaccttgagtaaggataacagacc
gttgcatatcaattttaacttttactctccgcattaaagaattcataaaagcaattctat
gatcctactaatttttgcaatgtgcttggaccaaattataaaccaatcaacttttatgaa
tagatggatgttgatgaattcttcttgtaactcatggacaaattggaactcgaactcaaa
ccattaaagagagatataattgtaccaaagagttttggtggatttatgagtacagaattt
ataagtaaaggatgttaacatcaatcttcaagagaagaattattcttggccctttcattg
caagtcaaaaataaaaagaacatttatgaatccatgaagatgatgactgatggtgaaatg
cttgaaggtgataatgcatacatgtgtgagaaatgcgaaaagaaggtgccagctctaatg
agagtctgcattaagcaattgcctaatgtattgatcatggtgttaaagcgttttgagttt
aattatgaaacccagtagaagtttaagttaaacgactattacgaattcccaactcaattg
aatatgaagcaattcaccaaggagtacttatagaagcaagattttcaagacgtcgaagat
gccgatagactcattgtgactgagtattcggatgaatattatgattaccacttgagagga
gtgattattcacgtcggtactgctgatcatggacattactattcattaatcaaagatgct
caaactaataagtggtatgaattcaatgatattcttgttaaaccttttgagtttggagat
ttggcaactgaagcatttggtaatgatgacaagggtagaagcaattaattattaagtcga
tctaaaaatgcatatatgttattttatgaacgcaagacttattttgatgaaaatggcaag
ccattgaagaatgattaggaattacgatggtttttcaataacaataaaaatgaaaagtaa
aatgatgaaattctgattgataatattaagttttaaatcagttaggttatgttcgatgaa
tccttttttgagttcagttgtgctctattggatgagggatcataaattcatatcggaaga
ttctgcttataatatttcctcactgttgtcatccgtttctaagagagaggacaatttgtg
ccaagatatttggaaaagttaaaattaataaccaggaattcagttcaattggcaaatgaa
tttctggtttctattcaaaatgttgatgttctaaatgagttgatcctctaaaatcccatc
caagacatgagagtaattataggtggtctgatcaacgatgccatcaagtgtcttatggac
aatgaaaagttcgcctcatataaagaattcaagcaaaagagcaacttaattcaactgacc
caatctatgattcactatatctagaataggaagaactctgattaaatccaaaggattatc
taccaattgtcattgaatgatttcagcaagacatacttacgagaactgaaattcgtaggg
agaatcttcctatactttttagatgaaccacctgttggcgctggttacattgaaattgca
gatcccaatgtcgaataaaaattactcaagatcaacaaataatatattaggaatgaatag
taaaatccacaaattttgcaatagtaagagaatcttaaatttgacaatctatacattgat
tactcctacttggttatggctcttaattaattgatctactaggatgatgacgaattgtgc
atgctcgatgatcctctgctctttaaaagactcctcagcattacattcacgagacaagca
aggttggctttgaaggaggcaatacagaaatatatacgactaaacaacaacccttgggat
caaagtctagcagttgtgtagacactctatgaacacatgaaggattgcgatgagaaagac
ttaaaaacagccttgatcgtacttaaaggaataggtgaaatcgatgatgcatacaacgaa
taaagattaactttggtggctgaagcttatatttctgctttgaaagacaacctgggttac
tggtattacacatcgattatgtttgattatgtaataaagatctgcacaagattgaatttt
cagaaagctttcgctgaagtcttgaatcgaaataaaggggtcttgaaattgatgtaccag
tggctaaaagaatcatagaatccattttaaaacttctcataataaaggtggaaagtcttt
aaaaagagacagatgaatgtgttggcttaggatataactgaaaaactgaataaattctag
gccttgtcctaaaaacgaatagagtcacttgagaaaatcatgagtcaataagttgtgaat
agtagtggttatgattctgatacagttcctaatcttgaataataggttgatgtcatcatc
ccagcaagaacatacctcaataacttcgagacttgtggctattcaacatggacaatcgga
atcaatttaggagatatgatggaattaagataaaacaatatgattaaatgggttttcagt
acggattcatcacttgcacctcccaacacatagacactaaaatatgaaaatcatgtttcc
tttatgaaatga

DBGET integrated database retrieval system