KEGG   Paramecium tetraurelia: GSPATT00031253001Help
Entry
GSPATT00031253001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00562  Inositol phosphate metabolism
ptm01100  Metabolic pathways
ptm04070  Phosphatidylinositol signaling system
ptm04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GSPATT00031253001
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    GSPATT00031253001
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    GSPATT00031253001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     GSPATT00031253001
Membrane trafficking [BR:ptm04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    GSPATT00031253001
 Endocytosis
  Macropinocytosis
   Phospholipase C
    GSPATT00031253001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_like GDPD EF-hand_8
Motif
Other DBs
NCBI-GeneID: 5014214
NCBI-ProteinID: XP_001428421
Genoscope: GSPATT00031253001
UniProt: A0BR56
Position
undetermined
AA seq 824 aa AA seqDB search
MKGRKSSASKFDRKEFDQRTLSAAVNLIVYGCHVQKYNKSNRKPISRLYYLYEEDMDYLQ
YLHAGRPFTQCRIPLLDIIELREIPTTESFQNLPYQRTLQITFASKKHTILFNTKNERDL
FWQGLQYFIDVAEHNLIRDIKSTNDNQIVEQITLKQIKGMLPQLSITKQELKSLFNQYDL
ERRGFISSSDYQDLLKRLMNQDFVRFIFDKYAVQQMNKQEFIKFLTNEQSPNQKQCEDAF
RLFAKQDGNNYSLSFLEFLNYLLSTYNQLFDYQKTQIYQSEDYPLTDYWINSSHNTYLMG
DQLTSESSIQAYINAFQKGCRCVELDCWDGDNNQPIIYHGFTMTSRISFESVIQTIKEYG
FKYSKYPLILSLEVHCCVKQQDVMADILKTYLNENLLLLPDDYKSSEYYPKLNKLYYKVI
IKHRGKMKSSLQYRERFISISPINIFQPNFEESESPDILKRPSLSIQGDQQQLNTPTTLK
PRSQKSFKRQDHGLPMLQLRNTINPFQIDEEMKPNKVIHKTKTETTLRPKYKISNIETQF
QFDAPNPRCQIVQLPLKVDSDEDISIDKAKKEKAESLKMSSITALFGAAIKQQNRTVWEI
SSLDESKVNENLLDFHRRYFTRIYPSGSRVDSSNYDPIPAFNSGSQIVALNFQTNDMPML
LNMCKFMENGGIESGYVLKPQWMRSDGKKKIGEFSSTQLSFTLSLLVGYNLRQLNNQNAK
VNPQIKISIRGLLQDEQNNKPQIATISQSGLNPQFNFIYKYNIKCPDLAFLIFEVLDASK
NFLGWSAIPLSCMSFGYRAVQLLSQYLKPLPKSCLLVHVQKNTD
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggacgtaagagttctgcatctaaattcgatagaaaagagtttgattagagaaca
ttaagtgctgcagtgaatttgatcgtttatgggtgtcatgttcaaaaatataataaatcg
aatagaaaaccgatatctagattatattatttatatgaggaggacatggattatttataa
tacttacatgcaggcagaccatttacacaatgtagaataccattgttagatatcatcgaa
ttaagagaaattccaacaacagagtcattctaaaatttaccttatcaaagaactctttaa
ataacatttgcgagcaaaaagcatacaattttatttaacacaaagaatgaaagggatcta
ttttggcaaggcttataatattttattgatgtggcagaacataatttgattcgagatata
aaaagcacgaatgataatcaaatagttgaataaatcaccttaaaataaattaaaggaatg
ctaccataattgtcaatcacaaaataagaacttaaaagcctctttaatcaatacgatttg
gaaagaagaggattcatttccagctctgattatcaagatttgctcaaaagattgatgaat
caggatttcgtgcgatttatattcgataaatatgcagtgtaataaatgaacaaataagaa
tttattaaattcttaacaaatgaataatctccaaatcaaaagcaatgtgaagacgcattt
agattgttcgccaaataagatggaaacaactattcgttatctttcttagaattcttaaat
tatcttctaagcacttacaattaattgtttgattatcaaaaaacataaatctattaatct
gaggattatcctttgactgattactggataaactcttctcataatacttatctaatgggt
gattaattgacaagtgaaagctccattcaagcttacataaatgcctttcaaaagggttgt
cgatgtgtagagttagattgttgggatggagataataatcaaccaatcatttatcatgga
ttcacaatgacttcaagaatatcatttgaatctgtcattcaaaccatcaaggaatatgga
tttaaatattctaaatacccattgattctctccctcgaagtccattgttgtgttaagcag
taggatgttatggcagatattttaaaaacctatttaaatgaaaatctcttacttttacca
gatgattataagtcttctgaatactatccaaagctaaataagctatattacaaagtaatc
ataaagcatcgaggcaagatgaaatcgagtttacaatatcgagaaagattcatatctata
tctccaattaatatattttagcccaattttgaagaatctgaaagtcctgacattcttaaa
agaccaagcctatcaatatagggtgattaataataattaaatactccaaccactctgaaa
ccaagatcttaaaagtcattcaagagacaagatcatggattacctatgctctaacttaga
aacactattaatccgttttagatagatgaggagatgaagccgaataaagtaatacacaag
actaaaacagagactacactaagacctaaatacaagatctcaaatattgaaacttagttt
taatttgatgcacctaatccaagatgttaaattgtgcaattaccgttaaaggtggattct
gatgaagacatatctattgacaaagcgaaaaaagagaaagctgaaagtctcaagatgagt
tcaataacagcattatttggcgctgcaattaaataacaaaatagaactgtttgggaaatc
tcttctttggatgaaagtaaagtcaatgaaaacttgcttgattttcatagaagatacttc
actagaatatatccatctgggtctcgagtagattcaagcaattatgatcctattccagca
tttaatagtggatcataaatagtggcactcaattttcagaccaatgatatgcctatgttg
ctcaatatgtgtaaatttatggaaaatggtgggattgaatctggatatgtgttaaagcca
taatggatgagatcagatgggaaaaagaagattggtgagtttagttccactcaattatcc
ttcactcttagtttattggttggttataatcttagataattaaataattaaaacgcaaag
gttaacccttaaattaagatttcaatacgaggtctgttataggatgaataaaataacaaa
ccgcagattgcaaccatctcataaagtggattaaatccttaatttaattttatctataaa
tacaatataaaatgcccagacttggcatttttgatatttgaggtactcgatgccagcaaa
aacttcttaggatggagtgccatacctctctcgtgcatgtcttttggctatagggctgtt
taactactgagtcaatacttaaagcctttgccaaagagttgcctccttgttcatgttcaa
aaaaacactgactga

DBGET integrated database retrieval system