KEGG   Paramecium tetraurelia: GSPATT00031296001Help
Entry
GSPATT00031296001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     GSPATT00031296001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 245 aa AA seqDB search
MFDFQFISVIIILGFSLAAWTADLLKIGYGKHLSHYMKLTLPPRIGWILYECPNLIWFVY
FLPAISLDFNRLPILLFVTHYFNRVIIYPLRLSPLARPIPVEVVASAILFTTCNGYIQIT
THLNRDLQLYLPDYLRILVGILIFIYGMTSNIKCDNILRGLKKENSNEYKIPYGNLFELV
SSGHYLGEIIEWFGYFLVSGQWSGFLFFFSTLSILSARAVSTHKWYKNKFDNYPKNRKAI
IPFIL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattttcaattcatatccgtaatcatcattttaggatttagtttggcagcctgg
actgctgatctcctaaaaataggctatggcaagcatctctctcattacatgaagttgact
ctgcccccaagaatagggtggatcctctacgaatgccctaacctcatttggtttgtgtat
tttctcccagccatcagccttgatttcaatagattgcccattctattgttcgtcacccat
tacttcaatcgtgtgatcatctatcctttaagactatctccacttgcaagacccatcccc
gttgaagtagtggctagtgccatcttatttacaacctgcaacggctatatctaaattaca
actcatttaaatcgagatctttaattatacctccctgattatttaagaattcttgtagga
atcttaatattcatctatggaatgacatctaatatcaaatgtgataacatcttgagaggg
ttgaagaaggaaaactcaaatgaatacaagattccatatggcaatttatttgagttggta
tcatctggccattacttaggtgaaataattgaatggtttgggtactttttggttagtggc
taatggagcggattcctatttttcttttcaaccttgtcaattctttcagctagagccgtt
tcaacccataaatggtataagaacaaattcgacaactatcccaaaaacagaaaagccata
attccatttattctgtga

DBGET integrated database retrieval system