KEGG   Paramecium tetraurelia: GSPATT00031342001Help
Entry
GSPATT00031342001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ptm  Paramecium tetraurelia
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GSPATT00031342001
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    GSPATT00031342001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     GSPATT00031342001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 705 aa AA seqDB search
MNKINHCGVNSLVYGQLLQVKLHKMKRTQMILLLSPNEVRLIQMLDPQGTFSTYFDLTQI
SDIQQKEESQLKIINSKGAYIKLYFQSAFQLITFREGLDYLIKEANRIQKQLDSYNQIWS
SALKLITQSDIDMDNKLNFKEFQFLIGELQIEIPERKLIQVFEKNQKNNQLDEATLYKLL
MDITRRHELKELYQKYSSKQEGMFEDPLQAMLMTDKDLQQFYKIEQGQADYQPKRKLYNF
YDFQNIIFNDENSIFQPKPLDQSQPITKYLINSSHNTYLERNQLTGESSCFAYQDAFKMG
FKCVELDCWDGENGEPKVTHGHTLVNDIKFKDVIITVRDFAFYKDDNPAILSLEMHCCLK
QQKRIAEILQSILGDMLFVIKDYKQEKMSTLQQLQRKVLVKYKADDQFLQEKLQLHSSTL
FFAQSHDDMQYKSQEFDDHKHQANIKQFSQTLDEHHTKICRELLEITSLYAVTLKLDKKP
ELVWIVSSVSEDKIQDIIKKSHGKFFEYVENYFVRIYPLGLRFDSSNYDPFPSWSAGAQM
VALNIQTKDLFMLQNYGMFLNSSYVLKSNQDVKMNIYVRIISATNLVWEEEKRRQEEIVD
PYIKIRVAGNHDDVNKSEKWRTEVVQDNGFHPIFNYQCSIQLRHAQQDVIYFQAYSYSIL
GDSLLGQYCLSPLNLRTGYRIVPLLNSHFKPLANCYVLVQIKIEY
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatcaatcattgcggtgttaattcgctagtgtatggatagcttttataggtg
aaattgcacaagatgaaacgtacttaaatgattttattgttaagtccaaatgaggttcgc
ttgatctaaatgcttgatccctagggcacgttcagcacttattttgatctcacttagatc
tctgacatttaataaaaggaggaatctcaattaaagattatcaactcaaaaggagcttat
ataaagttgtattttcaaagtgcgttttaattgatcactttcagggagggattagattat
ctgattaaggaagcaaacagaatccaaaaacaacttgatagttataattaaatttggagc
agtgctctcaagttgatcacacaatccgatatagatatggataataaactcaattttaag
gagtttcagttcttgataggtgaattgcaaattgagattccagagagaaaactaatacag
gtctttgagaaaaatcaaaagaataatcaattagatgaagcaaccttatataaattattg
atggatataacacgcagacatgaattaaaagaattatattagaaatatagcagcaaacag
gaaggaatgtttgaagatccactctaagcaatgttgatgacagataaggacttgtaatag
ttttacaaaattgaacaaggctaagctgattatcaacccaaaagaaaattatacaatttt
tatgatttttagaatatcatatttaatgatgagaactcaatatttcaaccaaaaccgtta
gattaatcctagccaattactaaatacttaataaattcatcgcataatacctatttggag
agaaattaattgactggggaatcaagttgttttgcatattaagacgccttcaagatgggg
tttaaatgtgttgaattggattgctgggatggtgagaatggagaaccaaaggttactcat
ggacataccttggttaatgatatcaaattcaaagatgtcattattacggttagagacttc
gctttctataaagatgataatcctgccattttatctcttgaaatgcattgttgtttaaaa
taataaaagagaatagcagaaattttataaagcattcttggagatatgttgtttgtcatt
aaagattataaataagagaagatgtctactttacaataattataaaggaaggttttagtt
aaatataaggcagacgatcaatttttataagagaaactataattacattcatccacatta
ttctttgcataatcacatgatgatatgtaatataaatcttaagagtttgatgatcataaa
cattaagcaaatatcaagcaattcagtcaaactctggatgaacatcatactaaaatatgt
agagaattattggaaattacttcattatatgcagtaacattaaagttagataaaaagcca
gaattagtttggattgtatctagtgtttcagaagataaaatataggatataataaaaaag
agtcatggcaaattttttgaatacgttgaaaattactttgttaggatttatcccttagga
ttgagatttgattcaagcaattatgatccattcccatcttggtcagctggggcttaaatg
gttgctttgaatattcaaacaaaagatttatttatgttgtagaattacggaatgtttctt
aacagttcttatgttttgaaatccaattaggatgtgaaaatgaatatctatgtaagaatc
atcagtgcaactaatctcgtttgggaggaagagaagcgtagacaagaagagattgttgat
ccctacattaaaataagagttgctggtaaccacgatgatgtcaacaaatctgagaagtgg
agaacagaggttgtttaggataatggattccatccaatttttaattattaatgttctata
taactcagacatgcttaataggatgtcatctatttttaagcatatagttattccatattg
ggtgattcattgttgggccaatattgtttgtcacctcttaatttaagaacaggttacaga
attgtcccattattaaattctcactttaaaccattagctaattgttatgtattagtgcag
atcaaaattgaatattga

DBGET integrated database retrieval system