KEGG   Paramecium tetraurelia: GSPATT00031622001Help
Entry
GSPATT00031622001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 474 aa AA seqDB search
MQNETNKRVAYFYHPQIGRYHYGKEHPMKPKRIAMAHNLIVNYGLYRNLDVYMNRQASLK
EMEKFHEPEYLQYLSQFTSVRSQIVNEYQHYNQQPNITHFTSHIYNEFDLLDYNIPHTHE
PIETNNNYPQPNSFRVGDSTDNPSFPGLYDFCQLSAGGSIDAAHVLISQDAEIAINYSGE
RPVGFCYVNDIVIAILELLRVHQRVLYVDIDVHHGDGVEEAFLLTNRVMTCSFHQYGDDF
FPGSGDIDSYGEGLGRYHALNIPLKIGMNDETFTEIFQKIITQVMDIYRPEAVVLQCGAD
SLCHDRLGGYNLSTKGHGACVEFMIKYNVPILVLGGGGYTIQNVARCWAYETGLCLNKKI
DAPIPTSEIYYEYYAPDYKLHFPIKQNVENKNKKEELQRIVEKIYGYLKSIEPVPGIGFH
DLPQSFYPEMNVEEEINPDQRYEQTLNQFEGAHYEEGNEILVDPSNGFSIHRRE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgagactaataaaagagtggcctatttttatcatccccaaatagggagatat
cattatggtaaggaacatccaatgaaaccaaaaagaattgcaatggcgcataatttaatt
gttaattatggtttgtaccgaaacctggatgtatatatgaatcggtaggcttcattgaaa
gagatggagaaatttcatgagccagaatatttgcaatatttgagtcagttcacaagtgtt
agaagtcaaattgtgaatgagtatcaacactataatcaacagccaaatatcactcacttt
acaagccacatctacaacgagtttgatttgttagattataatataccacatactcatgag
cccatcgagacaaataataattatccataaccaaatagtttcagagtaggagactccact
gataaccccagctttccaggtctatatgacttttgccaattgtctgcaggaggatcaatt
gatgctgctcatgtgttgatttcataagatgcagaaatagccattaattattcaggagag
aggccagtgggattctgttatgtgaatgacattgtgatagccatattggaattgttgaga
gtacaccagagagttttgtatgttgatatcgatgttcatcatggagatggagttgaagag
gcatttcttctcacaaatagagtgatgacttgttcattccatcaatatggagatgatttc
tttccaggctcaggagatattgacagttatggagaaggattaggtcgatatcatgctctc
aatatccctttgaaaattggtatgaatgatgagaccttcacagaaatattccagaaaatc
atcacctaagttatggatatctatagaccagaggctgtagtcctgtaatgtggagctgat
tcactatgtcatgatagattgggaggatataatttatcaacaaaaggtcatggtgcttgt
gttgaattcatgattaaatacaatgtgcccatcttggtattaggaggaggaggatataca
atctaaaatgtagctagatgttgggcatatgagactggattgtgtttaaacaaaaagatt
gatgctcctattcccacttctgaaatctattatgaatattatgctccagactacaaattg
catttcccaataaaacaaaatgtagaaaacaagaataagaaggaagaactccaaagaatc
gtagagaaaatatatgggtatctcaaatccattgaacctgttcctggcattggttttcat
gatttgccttaatcattttatccagaaatgaatgtagaggaagaaatcaatcccgatcaa
cgttatgaataaacattaaattaattcgagggagcccactatgaagaaggaaatgaaatt
ttagttgatccatccaatggattctcaatacatagaagagaatga

DBGET integrated database retrieval system