KEGG   Paramecium tetraurelia: GSPATT00031782001Help
Entry
GSPATT00031782001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     GSPATT00031782001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   GSPATT00031782001
Membrane trafficking [BR:ptm04131]
 Autophagy
  Other autophagy associated proteins
   Others
    GSPATT00031782001
Mitochondrial biogenesis [BR:ptm03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    GSPATT00031782001
  Mitophagy factors
   Other mitophagy factors
    GSPATT00031782001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like KA1
Motif
Other DBs
NCBI-GeneID: 5014732
NCBI-ProteinID: XP_001428948
Genoscope: GSPATT00031782001
UniProt: A0BSN3
Position
undetermined
AA seq 535 aa AA seqDB search
MQQQGQAPLQIEHYIIGKTLGVGAFGKVKLAKHNITNTQVAIKIINKRKMKNSRMGAKIR
REIRLLRYFNHPNVIKLYEVLDTPGDIFVVMEYAERGELFDLIAQRGKLPESEARNFFLQ
ILSGVEYCHNNLVAHRDLKPENILITHNYVVKIADFGLSNLMKDGKYLKTSCGSPNYAAP
EVISGKTYCGSDADVWSCGVILYALLAGFLPFDEETTQALFKKIKSADYTIPSSFSPQVR
DLINKMLTPDPLKRIKFHEIHLHPYMRSTQVPFYLQIPFKLDEGRRQINEDVFEKLMQLQ
TVNFRGMTQTQIQKSIRKREDKSFVVIYDLLLGQLGVESSTPMTLHNLTMHDLIFNPQIP
QIEGQSFNNCLLNEIQKPQPYDYGKELPKDIMAIVYPYQARQIVNAIYTCLEKFNTVIKI
KSPDYKLKCYHKNLIKMTKYNSSMELFNEFQKEVEETGSKNDLASLTFKDDGKKPKIKEN
KYSAKEIIFNIQIYKMPTNNNDHMIDFQLCRGHPVVFMDFCNKVIALLNQHFNQI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtaataataaggataagctccattataaatagaacattacataataggtaaaacattg
ggtgtgggtgcattcggaaaagtcaaactggctaaacacaatattactaatacataagtg
gccatcaaaatcatcaataaaagaaaaatgaagaattcaagaatgggtgctaagataagg
cgtgaaataaggttgctcagatattttaatcatcccaatgtaattaaactatacgaagta
ttggacaccccaggagatatatttgtagtaatggaatatgcagaaagaggagaattattt
gatttgatcgcataaagaggcaaattgcctgagagtgaggctcgcaactttttcctttaa
atattaagtggagtcgaatattgccataacaatttagtagcccatcgtgatctcaaacca
gaaaacattctgattactcataattatgttgtcaaaatcgcagacttcggattaagtaat
ctgatgaaagatgggaagtatttaaaaacctcatgtggttctccaaattatgctgcacct
gaagtgatatcaggaaagacttattgtggttccgatgctgatgtttggagttgtggagta
attttgtatgcattacttgcaggtttcttaccctttgatgaagaaaccacccaagctctc
tttaaaaaaatcaaaagtgctgattacaccatcccaagtagtttcagtcctcaagtgaga
gatctcattaataaaatgctcactccagatccattgaagagaatcaaattccatgagatt
catcttcatccatatatgagaagcacttaagttcccttttatctccaaataccattcaaa
ttagacgaaggacgtagataaatcaatgaagatgtctttgagaaattaatgcaattgcaa
acagttaattttagaggtatgacacaaacataaattcagaagagtatcagaaaaagagaa
gacaaatcatttgtagtcatttatgatttactattgggataattaggagttgaatcttct
actcccatgactctacacaatttaactatgcatgatctaatctttaatcctcaaattcca
taaattgaaggacaatcattcaataattgtctattgaatgaaatttagaagccttagcct
tatgattacggtaaggaattaccaaaagacataatggcaattgtttacccttatcaagcg
agataaatcgtaaatgctatttacacttgtctagagaaatttaatactgttattaagata
aagagtcctgattacaagttgaaatgttatcataagaatctcataaagatgacaaagtat
aattcgagcatggagttattcaacgaattccaaaaagaagtggaagaaacaggatcgaaa
aatgatttggcttctctgacttttaaggacgatggcaagaaaccaaaaattaaggaaaat
aaatattcagccaaagagattatatttaacatctaaatttataagatgccaactaacaat
aacgatcacatgattgatttccaattatgcagaggtcatcctgtggttttcatggatttt
tgcaataaagtgatagctttgctaaattaacacttcaattaaatttga

DBGET integrated database retrieval system