KEGG   Paramecium tetraurelia: GSPATT00031782001Help
Entry
GSPATT00031782001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ptm  Paramecium tetraurelia
Pathway
Regulation of autophagy
Class
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:ptm04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 535 aa AA seqDB search
MQQQGQAPLQIEHYIIGKTLGVGAFGKVKLAKHNITNTQVAIKIINKRKMKNSRMGAKIR
REIRLLRYFNHPNVIKLYEVLDTPGDIFVVMEYAERGELFDLIAQRGKLPESEARNFFLQ
ILSGVEYCHNNLVAHRDLKPENILITHNYVVKIADFGLSNLMKDGKYLKTSCGSPNYAAP
EVISGKTYCGSDADVWSCGVILYALLAGFLPFDEETTQALFKKIKSADYTIPSSFSPQVR
DLINKMLTPDPLKRIKFHEIHLHPYMRSTQVPFYLQIPFKLDEGRRQINEDVFEKLMQLQ
TVNFRGMTQTQIQKSIRKREDKSFVVIYDLLLGQLGVESSTPMTLHNLTMHDLIFNPQIP
QIEGQSFNNCLLNEIQKPQPYDYGKELPKDIMAIVYPYQARQIVNAIYTCLEKFNTVIKI
KSPDYKLKCYHKNLIKMTKYNSSMELFNEFQKEVEETGSKNDLASLTFKDDGKKPKIKEN
KYSAKEIIFNIQIYKMPTNNNDHMIDFQLCRGHPVVFMDFCNKVIALLNQHFNQI
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtaataataaggataagctccattataaatagaacattacataataggtaaaacattg
ggtgtgggtgcattcggaaaagtcaaactggctaaacacaatattactaatacataagtg
gccatcaaaatcatcaataaaagaaaaatgaagaattcaagaatgggtgctaagataagg
cgtgaaataaggttgctcagatattttaatcatcccaatgtaattaaactatacgaagta
ttggacaccccaggagatatatttgtagtaatggaatatgcagaaagaggagaattattt
gatttgatcgcataaagaggcaaattgcctgagagtgaggctcgcaactttttcctttaa
atattaagtggagtcgaatattgccataacaatttagtagcccatcgtgatctcaaacca
gaaaacattctgattactcataattatgttgtcaaaatcgcagacttcggattaagtaat
ctgatgaaagatgggaagtatttaaaaacctcatgtggttctccaaattatgctgcacct
gaagtgatatcaggaaagacttattgtggttccgatgctgatgtttggagttgtggagta
attttgtatgcattacttgcaggtttcttaccctttgatgaagaaaccacccaagctctc
tttaaaaaaatcaaaagtgctgattacaccatcccaagtagtttcagtcctcaagtgaga
gatctcattaataaaatgctcactccagatccattgaagagaatcaaattccatgagatt
catcttcatccatatatgagaagcacttaagttcccttttatctccaaataccattcaaa
ttagacgaaggacgtagataaatcaatgaagatgtctttgagaaattaatgcaattgcaa
acagttaattttagaggtatgacacaaacataaattcagaagagtatcagaaaaagagaa
gacaaatcatttgtagtcatttatgatttactattgggataattaggagttgaatcttct
actcccatgactctacacaatttaactatgcatgatctaatctttaatcctcaaattcca
taaattgaaggacaatcattcaataattgtctattgaatgaaatttagaagccttagcct
tatgattacggtaaggaattaccaaaagacataatggcaattgtttacccttatcaagcg
agataaatcgtaaatgctatttacacttgtctagagaaatttaatactgttattaagata
aagagtcctgattacaagttgaaatgttatcataagaatctcataaagatgacaaagtat
aattcgagcatggagttattcaacgaattccaaaaagaagtggaagaaacaggatcgaaa
aatgatttggcttctctgacttttaaggacgatggcaagaaaccaaaaattaaggaaaat
aaatattcagccaaagagattatatttaacatctaaatttataagatgccaactaacaat
aacgatcacatgattgatttccaattatgcagaggtcatcctgtggttttcatggatttt
tgcaataaagtgatagctttgctaaattaacacttcaattaaatttga

DBGET integrated database retrieval system