KEGG   Paramecium tetraurelia: GSPATT00031783001Help
Entry
GSPATT00031783001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GSPATT00031783001
Transcription machinery [BR:ptm03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     GSPATT00031783001
Chromosome [BR:ptm03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    GSPATT00031783001
   HAT complexes
    PCAF complex
     GSPATT00031783001
    STAGA complex
     GSPATT00031783001
    TFTC complex
     GSPATT00031783001
    SAGA complex
     GSPATT00031783001
    SLIK complex
     GSPATT00031783001
    ADA-HAT complex
     GSPATT00031783001
    HAT-A2 complex
     GSPATT00031783001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 387 aa AA seqDB search
MSQQFVGINGEQTGLGFTNRDQGAKVEEDQGLIDFKIITNNGNHERMKMLIDLKNIFARQ
LPKMPKEYIVRLVFDRNHESMCIVKDDTKVIGGICYRKYPTQRFAEIAFLAITANLQVKG
YGTRLMNKFKEHIQKQDVEYLLTYADNYAIGYFRKQGFYQEIKMHPDRWKGFIKDYDGGT
LMECYVHPSIDYGNISDLIREQKQLMIDMIKKLTLNDRVYPGIEKQNYKMETSNGDRPAV
KPESVQGIMESGWTIEDYNELKKQKEKTFMISCQQIIDTMRKHKSAWPFLEPVNKDDVPD
YYDVITDPIDIKTIEKKLQNNQYTSKDLFIKDVKRIFINCRNYNQPDTIYYKCANELERT
IDDYLKKLKDESQIPGVSKKIKKTNNK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaataatttgtgggaataaatggagaatagactggtcttggatttaccaaccga
gattaaggagccaaggttgaagaagatcaaggtttgattgacttcaaaattataacaaat
aatggtaatcacgagagaatgaagatgttaattgacttgaaaaatatattcgctcgccaa
cttcctaaaatgccgaaggaatatattgttagacttgtatttgatagaaatcatgaatca
atgtgcattgttaaagatgatacaaaagtgataggaggaatctgttacagaaagtatccc
acttaaagatttgctgaaatagcatttctggcaattacagccaacttgtaagtcaaagga
tatggaacaagattgatgaacaaattcaaagaacatatacaaaaataggatgtcgaatat
ttgctgacttatgcagacaattatgcaattggatatttcagaaaacagggattctattag
gaaataaagatgcatccagacagatggaaaggattcatcaaggattatgatggaggaacg
ttgatggaatgttatgtgcatcctagtattgattatggaaacattagtgatctgattaga
gaataaaagtagctcatgatagacatgatcaagaaattaacattgaatgatcgagtatat
cctggcattgagaagcagaactacaaaatggaaacttccaatggagatagacctgcagtc
aaaccagaaagtgtttaaggcattatggagagtggttggacaattgaggattacaatgaa
ttgaaaaagtaaaaggaaaagacttttatgatctcatgctagtagatcatagacaccatg
agaaaacataaatctgcctggcctttccttgaacctgtcaataaggatgatgtccctgat
tattatgatgtgattactgatccaattgatattaagactattgaaaagaaattacagaac
aattagtatacttccaaagacctctttatcaaggatgtaaagaggatcttcatcaattgc
agaaattacaatcaacctgatacgatatactataaatgtgcgaatgaattggagagaacc
attgatgattacctcaaaaagttgaaagatgaatcccaaataccaggtgtcagcaagaag
ataaagaagacaaataataaatga

DBGET integrated database retrieval system