KEGG   Paramecium tetraurelia: GSPATT00032888001Help
Entry
GSPATT00032888001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     GSPATT00032888001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 597 aa AA seqDB search
MKKKDIILEYKLFKRYVQHLQFKLLQEESHNTQSINVKINRNRYYQIDLKVNKNRDNLPL
MTNHYKSIPQNIRLQNPTPVLLERLSTNINYLAPMSVELSQGEETEELFKTIEQAQQESI
EKSKQLLRNELKVFLDYLFEKYKELFSSIKDVFKFNEIAEALNVSVDQIQLHFLSKLQGR
YSMRSVVKYQFVRFNRYFCPICNLYMCSWHYSSKNQRVFIESEPNVEMPINIQSIDNFYE
TDFKPNQINLKDSIWRYHMRNKQEIDIRCTKIERCGRYNCDNKKRLKKFQIKSIQQLLEF
GFENCCFINQILQHPVYKIYCDQISYIIKNYSNNQENLNNKPQQNIMSPEIYEGFDSYSQ
KLHKITNYQQQYTPCFHQGSCKDADCSCVMCPRYCCCKGKCEKKIKRCDCKNCGYDEKKR
KFQCTCFNLGFECDPSICKCTNCNNVNLTLGISKQLILGNSLICNGIGLFAAQHFKTYDF
IGEYRGNYLLLDEESYIIEQCNMLTGKHYLFEVDDKWQVDGTYYSNYLRFINHATNQSET
ANCQAIILFSEGRWKIGMLATREIEVGQELYFDYGDKFKTKWLQEFNKISERYFQGK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaggacatcattctagaatacaaactttttaaacgatatgtgcaacactta
caattcaaattactttaagaggaatctcacaatacataatcaataaatgtcaagatcaat
agaaatagatactactaaattgaccttaaagtgaataaaaatagagataatcttccttta
atgactaaccactacaaaagcataccctaaaacatcagattataaaatccaactcctgtt
ttacttgagagattaagtacgaatattaactacttagcacctatgtcagttgagttgtca
caaggcgaagaaacagaagagctatttaaaaccattgaataagcttaataggaaagtatt
gaaaaaagtaaataactcttaagaaatgaattaaaagtgttcttagattatctttttgaa
aaatacaaagaattgttcagctctattaaagatgtattcaaatttaatgaaattgcagaa
gctttgaatgtttcagtagattaaatttaattgcattttttatcgaaattataagggagg
tactctatgaggtctgttgtgaagtatcaattcgtaagattcaacaggtatttttgtccc
atttgcaatctgtatatgtgtagttggcattatagttcaaagaatcaaagagtgtttatt
gagagtgaaccaaatgtggagatgccaattaatattcaatcaattgataatttttatgaa
acagacttcaaaccgaatcaaataaatttgaaagatagtatttggagatatcatatgaga
aataagtaagaaatagatataagatgtactaaaattgaaagatgcggtagatacaattgt
gataacaaaaaaagattaaagaaattttaaataaaatctattcaataactacttgaattt
ggttttgaaaattgttgctttatcaattaaatattacagcatcctgtctataagatttac
tgtgattaaattagctatataatcaagaattactctaataattaggagaaccttaataat
aaaccacaatagaatattatgtctccagagatttatgaaggatttgattcttactcttaa
aaattacataaaattactaattactaacaataatatacaccttgttttcattaaggcagt
tgcaaagatgctgattgcagttgtgtgatgtgtccgagatactgttgttgcaaaggtaaa
tgtgaaaagaagattaagaggtgtgactgcaaaaactgtgggtatgatgaaaagaaacgt
aaattttaatgtacttgtttcaatttaggatttgaatgtgatccatctatttgcaaatgt
acaaattgcaataacgtcaatttaactctgggaatatctaaatagctaatcttaggaaac
tctcttatttgtaatggtataggcttatttgctgcatagcattttaaaacatatgacttc
ataggggaatatagaggaaactatctgttgttggatgaagaaagctacattatagagtaa
tgtaatatgcttactgggaaacattacttgtttgaagttgatgataaatggcaagtggat
ggaacttattatagcaattatcttagattcatcaatcatgcaactaattaatcagaaacc
gcaaactgttaagccattatactattttctgaaggaagatggaagattggaatgctcgca
actagggagattgaagtaggataagagttatactttgattatggggataaattcaaaact
aaatggctataagaatttaacaaaattagtgaaagatatttttagggcaaatga

DBGET integrated database retrieval system