KEGG   Paramecium tetraurelia: GSPATT00033101001Help
Entry
GSPATT00033101001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ptm  Paramecium tetraurelia
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:ptm04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 663 aa AA seqDB search
MIEEEGQQVKSQLEQQLIEAILDSLQNHMDQNAIFLAERLVYERDTEEHRSILAECYLHE
NQAYKACHILKECKSEFNRYQLAVAWFRSKKYKEAEMALIGPSFSNQFAIQSTNVPNGGF
GHFLLGQIYEQMHRLEDAKIQYYKALDQNPTLWMAFERLSKIGEPVAINKVFIEQKQRQY
ETSRQQSCNIYKIIANLLKSKSNIGKSGSKEVEDVKEESLITDNQLANKRQTQGVKPFST
TGVQAQIMHMDDSSNSQMKFSCKFNMIIFQEPQQKKVGAKMIPTPGIGLQNYQSLLSQPF
QLSQNSNKNYNAKKSEIQKVALSSSSSSLMNLPQLLKLFAHPYQLWTNYSVEAIANFQKL
PPQHYRSGWVLEKVARSFMDQVKYTDAERVWKELRQIEPTRLEGMDYYSSCLWHLKKQSE
LTYLAHSCLQISTQAPETWIAIGNCFSLTKEIDNSIKFFGRAIQLRKDYSYAYTLSGHEF
SQNENFQQAKKSYEAATSLDQRQYNAWWGQGNMYYKTDKYEDAIKCFIQAIRINPNNPVL
PTFLAMSYAAKGEHNDALKYFEQSERLDPMNGLNKYQKANSLIKMDKYEQALSELQTLSQ
FIPKEAAIYILMGRILKKLNKIQEAQNCFNMAMSLDMKDQAKIKGLMESLSNPNSEFNDD
FDL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagaagagggacaacaagtaaagagctaattggaacagcaattgatagaagca
attctagactcgctatagaatcatatggaccagaatgccatctttttggctgagagattg
gtgtacgaacgagacacagaggagcacagatcaatcctagcagaatgctatttacatgag
aatcaggcttataaggcatgtcatatattgaaggaatgcaagtcagagtttaatcgttat
caactggctgttgcatggttcaggagtaaaaaatacaaggaagctgagatggcattaata
ggaccttcctttagcaatcaattcgcgatatagtcaacaaatgtgccaaatggaggtttt
ggccacttcttattgggatagatttatgaacagatgcatagactagaagatgccaaaatc
taatattacaaggctttggattagaatccaactctttggatggcctttgaaaggttgtcc
aagattggagaaccagtcgcaatcaataaagtgtttattgaacaaaaacaaagacaatat
gagacaagcagataatagagttgtaacatttacaaaataattgctaacttacttaaaagc
aaatcaaatattggcaaatcaggttcaaaagaagtcgaagatgttaaagaagaatctcta
ataactgataatcaattggcaaataagagataaactcaaggagtgaaaccattctcaact
actggagtgtaggcttaaataatgcatatggatgactcatcgaatagttaaatgaagttt
tcctgtaagtttaatatgataatattttaagagccttagtagaagaaggtgggggccaag
atgatcccaactcctggtattggactccagaattatcagtctctactgagtcaaccattc
cagttatcataaaattcaaacaagaattacaatgcaaaaaagagtgaaatccagaaagta
gctctttcatcatcatcatctagtttaatgaacttacctcaactcttaaaattatttgct
catccatatcaattgtggactaactattctgtggaggcaatagccaatttttagaaactg
cctcctcagcattacagatcaggatgggttttagagaaggttgccagaagctttatggat
taagtcaaatatacagatgctgaaagagtttggaaggagttgagacaaattgaacccact
cgattggagggtatggattactactcatcttgtttatggcatttgaagaaataatcagaa
ttaacatatttagcacactcttgtttataaatctctactcaagcacctgaaacatggatt
gcaattggaaattgttttagtttgaccaaagaaatagataattcaatcaaattctttggg
agagccattcaattgaggaaagattactcttatgcttacactttgtctggacatgaattt
tcacaaaatgaaaactttcaataagccaaaaaatcatatgaggctgccacctcattagat
tagagacaatacaatgcttggtggggttagggtaatatgtattacaagacggataaatat
gaggatgccatcaaatgcttcatctaagccatcagaataaatcccaataatcctgttcta
cctacatttttagctatgagttatgctgccaagggtgaacataatgatgctttgaagtac
ttcgaatagagtgagaggttagatcccatgaatggacttaacaaatactagaaagcaaat
tcattgattaaaatggataaatacgaataagctttaagtgaattgcagactttgagttaa
tttattcccaaagaggctgccatctatattcttatgggtcgtatattaaaaaagttgaat
aagatccaagaagcataaaattgtttcaatatggcaatgtcacttgatatgaaagattag
gctaagattaaagggctgatggaaagtctgagcaatcccaacagcgaattcaacgatgat
tttgatttatga

DBGET integrated database retrieval system