KEGG   Paramecium tetraurelia: GSPATT00033550001Help
Entry
GSPATT00033550001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
ptm  Paramecium tetraurelia
Pathway
ptm03013  RNA transport
Module
ptm_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    GSPATT00033550001
Messenger RNA biogenesis [BR:ptm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     GSPATT00033550001
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     GSPATT00033550001
Translation factors [BR:ptm03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    GSPATT00033550001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 5016881
NCBI-ProteinID: XP_001431095
Genoscope: GSPATT00033550001
UniProt: A0BYT0
Position
undetermined
AA seq 200 aa AA seqDB search
MGDQFYQLCSKWTVSEKYNASLNVDYKKTIVDVCSFNTIEEFAYLMKKTIYSKLSDVLSE
PQKCKIFKQFNDEVTDVQIEAIQFFKNDIKPWWEDESNKNGGEIQFDIPTQFYNIYDNLY
QDILYEVIGQSNEDLRHINGLRVVDKINAKQGNRIRIELWLDIDPKDKHDSILKLDEWLV
SLIQKYHIEQTQLTQVSHKK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattaattttatcaattatgttcaaaatggacagtgtcagagaaatataatgct
agtttgaatgttgattataagaagacaatagtagatgtttgttcattcaatacaatagaa
gaatttgcttatttaatgaaaaagactatctattcaaaattatcagatgtcttaagtgag
ccataaaaatgcaaaatctttaaataatttaatgatgaggttacagatgtttaaattgaa
gcgatataatttttcaagaatgatataaaaccttggtgggaagatgaaagtaataaaaat
ggtggtgagatctaatttgatataccaacataattttataatatatatgataatttatac
taagatattttatacgaggtgatagggtaatcaaatgaggatttaagacatataaatggt
ttaagagttgtcgataaaataaatgctaaacaaggaaatagaataagaattgaattatgg
ttagatattgatcccaaagataagcatgactctattttaaaattagatgaatggctcgta
tccttgattcaaaaatatcatattgagtaaactcaactcacttaagtgtcacataaaaaa
tga

DBGET integrated database retrieval system