KEGG   Paramecium tetraurelia: GSPATT00033550001Help
Entry
GSPATT00033550001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ptm  Paramecium tetraurelia
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    GSPATT00033550001
Translation factors [BR:ptm03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    GSPATT00033550001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 200 aa AA seqDB search
MGDQFYQLCSKWTVSEKYNASLNVDYKKTIVDVCSFNTIEEFAYLMKKTIYSKLSDVLSE
PQKCKIFKQFNDEVTDVQIEAIQFFKNDIKPWWEDESNKNGGEIQFDIPTQFYNIYDNLY
QDILYEVIGQSNEDLRHINGLRVVDKINAKQGNRIRIELWLDIDPKDKHDSILKLDEWLV
SLIQKYHIEQTQLTQVSHKK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattaattttatcaattatgttcaaaatggacagtgtcagagaaatataatgct
agtttgaatgttgattataagaagacaatagtagatgtttgttcattcaatacaatagaa
gaatttgcttatttaatgaaaaagactatctattcaaaattatcagatgtcttaagtgag
ccataaaaatgcaaaatctttaaataatttaatgatgaggttacagatgtttaaattgaa
gcgatataatttttcaagaatgatataaaaccttggtgggaagatgaaagtaataaaaat
ggtggtgagatctaatttgatataccaacataattttataatatatatgataatttatac
taagatattttatacgaggtgatagggtaatcaaatgaggatttaagacatataaatggt
ttaagagttgtcgataaaataaatgctaaacaaggaaatagaataagaattgaattatgg
ttagatattgatcccaaagataagcatgactctattttaaaattagatgaatggctcgta
tccttgattcaaaaatatcatattgagtaaactcaactcacttaagtgtcacataaaaaa
tga

DBGET integrated database retrieval system