KEGG   Paramecium tetraurelia: GSPATT00033792001Help
Entry
GSPATT00033792001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 1754 aa AA seqDB search
MLQSFLNCFKKQPKFRMNRDYEKDILSSVQDILPQSFQKHQYNKQNMNQIESHNKEFQAT
NDLNRLNQEQGIFSPNPSQANIRLHFLENVDEQFQKNENPYYCQFSLDYFGMNNKFRQYC
ILINESRVYQYSVYIFTTFCIVILMIKPYNGQKSGFGFSLNDDQILGVIVTADVIFAAHH
LISIVSYGYLEQLCRLWSCKYGYYRNPIAFINGIALFFALILRQSYFYTLRILFLLEFFM
HYKILRIVRKFCLTVEHSFISIVYITIIICFFFYVFAVVGLQIWTGIIGNQCINKDNEVD
YYPTRFCGLGRSCSDGYECQQAQFEQPFIQYSHNFTKFDYIQESMASLFIVHYIEGWVEI
EQSLADSFNKYVSTGYLWTYIFICSFFLQNLVVAIFLKQSQQEVHLDEPAQTVLFLNSHT
KISLTNEKRKTVFQSPNYLSRSKQRVMTMLMNSTKRSSDQRKIRVIIKSILSSKITQYFY
SLLFLANLVVLSLNDESAYINKLEGTLAKINVVFLVIYLIEDIARIYIWKQKESKIIVLL
EFICDFVGLIVQVNQLEHPFILNTIKGIRLLWVFNYQTSWSNYRVLLSALWKSFNNIPIM
ILILFIYGLVIGLMGRNFFAGKLRFNDLGFYDLDGSYIPRANFDSMRETITTLFIIISSD
QWQTIFYTTLETGSWIPYIFFICVQFICKFFILPSFLTLMLDNYEDAKNEADISKARATK
IISTMQNKSRIVPTKETSLLQVSNSQSEKKRFFGRLSKVSDDSEKEETHSKQHPALKRQQ
SKYQQVQIFKSSDDFQIISLYQQNWKEFFGNSSLFILHNRSNLRKKLHILIQSKYYDWAM
SFIILSNLILLGYDQPLRKENLVIDVFNYAFTGIFILDAFIKILAQGFYWNKQEPQKSYI
MNNNNQLDFVVLIISSLDDLNIYKSQYLRAFRALRTLRILITLRRGSQNEQLNLISRSLL
QTISLLSSMIFVTGISLWILSIICMTIWKGKLYFCSQVSLKDFQDIVNVEDCLAKGGQWI
NNITNYDTIQDSLLCLFRLIIGEGWTQQMFSVSDITNRGLNPKINSSSQYQFFFYVLIFS
LNIVLLNLITGLIINNYRTIKENIANFQQLNEFQRQWIQMMQIMQKKKLIYLIPKPSSKY
RLICYHLASNQYFETVILILLVVNLILQLLHSYLQSITTQEALYGMSIFFIVIFHVELFI
KLLAYWVHFFRDILNKFDIIILIVTDVLLIMKDSFDLPRLYTIPLIIRSLRIIKANKLFR
FNKQLRVLIDVIQDLIPTLLSVIVFIAITIIIYSLIGVQTFSTVWSTSSDPHQRTKSFSN
FLDGVLILIDISTGQYWSLYMADYTIDTKGCHAQTPEQFESEGARGCSTIFGYFFFISFL
VLIRIIMTSLFLAMIIESYQECQLENTAAINPYQLEDFLVKWSDYDPQGTGWITPEDFAF
LMFEINPPLGFKDENSQYYDFAAAKNQKLKSHFYNHKKKMRLFKTEIFQKLSDYQVQIYQ
NKMVHFKDICIQLAYNAIKKKNELKGIEQIEDKIILRQIRKSWESRYPDLVGMKTQQFVV
DIFAFNSITDILRGVIERRKIKKRIKEMQKEKNLKQLEINENAYITTKTLLERNKGRRRS
QIRKKVYNFQQTNVQRRSEINVDIEQAIHQPKRAMHQNYQKQQQNKDDKNSLTSLNFYID
PDEMCNGFPMKVVHETQKIDFPAIKSDKSLGTLQATQSEKQVKKLGGYISEKCSDEENQQ
DSVIQNFKRDDMFE
NT seq 5265 nt NT seq  +upstreamnt  +downstreamnt
atgctttagtcttttttaaattgcttcaaaaagtaaccgaagtttaggatgaatcgcgat
tatgagaaggatatcttatcttcagtttaggacattttgccatagtccttttagaaacat
tagtataacaagtaaaatatgaatcaaatagaaagccataataaggaattttaggcaaca
aatgatttaaataggttgaattaagagtaggggattttttcaccaaatccatcgtaagca
aacattcgattacactttttagaaaatgttgatgaacagttttaaaaaaatgagaatcct
tattattgctaattttctttggattattttggaatgaataataaatttcggcaatattgc
attttaataaatgaatctcgagtttattaatattctgtgtacatattcacaacattttgt
atagtgattttgatgatcaagccttacaatggtcaaaagagtggatttgggttcagttta
aatgatgatcagatcctgggagtaatagtcaccgcagatgtgatatttgctgctcatcac
ctaatatcgatagtttcatatgggtatttagaataactatgtaggttatggagttgtaaa
tacggatactacaggaacccaatagcattcataaatggaatagccttgttcttcgcctta
attttgagacaatcttacttttatacattaagaatactatttttgcttgagttttttatg
cactacaaaattttaagaatagtccgaaaattttgtttgacagtagaacattcatttatc
tcaattgtttacatcacaataataatttgctttttcttttatgtgtttgcagtggtagga
ttacaaatttggactgggattatcggaaattaatgcatcaacaaagataatgaggttgac
tactatccaactcgattttgtggtttgggaaggtcttgttctgatggatatgaatgtcag
caggctcaatttgagtaaccattcatttagtattcacataatttcactaaatttgattac
attcaagaatcaatggctagtttgtttatagtccattatattgaaggatgggtagaaatt
gaatagagtttggctgactcattcaataaatatgtgagtactgggtatttgtggacttat
atttttatttgttcattctttttgtaaaacttggtggttgccatatttctgaagtaatct
caacaagaagttcatttagatgaaccagcttaaacagttttatttttaaatagtcatacc
aaaatatcattaacgaatgaaaaaagaaagactgtgttttagagtcccaattatcttagt
agaagtaaacaaagagttatgactatgcttatgaattcaactaaaagaagtagtgattaa
agaaagattagagtaattatcaaatctattttatcttcaaaaataacgcaatatttttac
agtcttttatttttggctaatcttgttgtgttgtctctaaatgatgaatcagcatatata
aacaaattagaaggaacattagccaaaataaatgtggtgtttttggtaatttatttaata
gaagacatagcaagaatctatatttggaaataaaaggaaagcaaaataattgtgttatta
gaatttatttgtgattttgttggtttgatagtccaagtcaattaattggaacatcccttc
atcttaaatacaatcaaaggaatacgattgctatgggtcttcaattactaaactagttgg
tcaaattatcgagttttattatcagccttatggaagtcgttcaacaacatccccatcatg
attttgatactctttatttacggtctagtgattggtttgatgggtcgtaacttttttgct
gggaaattaagattcaatgatttaggattctatgatttggatggttcctatattccaagg
gctaatttcgacagtatgagagagacaattactacattgtttataatcatatcttcggat
taatggtaaaccatattttatactacattggaaactggatcttggattccgtatatcttt
ttcatttgtgtctaatttatttgtaaattttttatacttccctcgtttttgactttgatg
cttgataattatgaagatgctaaaaacgaagctgatatttcaaaagctagagctactaaa
attatttcaacaatgcaaaataaatctagaattgtaccaacaaaagagacctcattattg
caagtcagcaattcataatctgaaaagaaacgcttctttggaagattgtctaaggtctct
gatgacagtgagaaagaggagactcattcaaaataacaccctgcgttaaaaagacaataa
tcaaaatattagtaggtgtagattttcaaaagcagtgatgatttctaaataatatcactt
tattaatagaattggaaagaattctttggaaattcatcactttttatcctacacaaccga
tctaatttaaggaagaaattacacattctcattcaatctaaatattatgattgggcaatg
agtttcattattttgtctaatttaatactcttagggtatgatcaacctctcagaaaggag
aatttagttattgatgtatttaattatgcatttactggcattttcatattggacgcattt
atcaaaatcctagcccaaggtttctattggaataaataggaacctcaaaaatcctatatc
atgaacaataacaattaattagatttcgtagtcctcattattagttctcttgatgatctc
aatatttacaagagctaatacttaagagccttcagagctctgagaacattaagaattctg
atcacattacggagaggatcgcaaaatgagtaactgaatctaatatccagatctttatta
taaaccatctcattactttcatcaatgatatttgttactggcataagtctgtggattcta
agtatcatatgcatgacaatatggaagggcaaactctatttttgctcctaagtatcgttg
aaagacttttaagatattgtcaacgtagaagattgtctcgccaaaggaggataatggata
aataatataaccaattatgatacaatccaagattccctactttgtttgttcagattaatc
attggagagggttggacctaataaatgtttagtgtatctgacatcaccaatagaggactc
aatcctaaaattaattcatcatcctaataccaattcttcttttatgtgttgatcttttca
ttgaatatcgtattgctcaatctaatcactggcttgatcatcaacaattacagaactatc
aaggagaacattgccaacttttagtaattaaatgaatttcaaagacaatggatataaatg
atgtaaataatgcaaaagaagaaacttatatatctcatacccaaaccttcatccaaatac
agactaatttgttatcatttggctagcaactaatacttcgagactgtcatcctaattttg
cttgtggtcaatctaattttgtaattattgcactcatatctatagagtatcaccacttaa
gaggcattatatggaatgagtattttctttatagtaattttccatgtggaattgttcatc
aaactactcgcatactgggttcatttcttcagagatattctcaataaattcgatattatc
atattgattgtgacagatgtgctcttgataatgaaggacagttttgacttgcctagactt
tacacgattccactcattataagatccctgagaatcataaaagccaataaattatttagg
ttcaataaacaattgagagttctcattgatgtgatctaagatctgattcctaccttattg
agtgtcatagtattcattgcaatcaccataatcatatattcactaataggagtccagacc
ttttcaacagtatggagcacgtcatcagatcctcactaaagaactaagtccttttcaaat
ttcttagatggagtcttgattttaatcgatatttctactggttaatattggtctttgtat
atggctgattatacaattgataccaaaggatgtcatgcccaaactcctgaacaatttgaa
tcggaaggtgctcgggggtgtagtacaatctttggttattttttctttattagctttctg
gttttgattcgcatcatcatgacttcattgtttttagccatgattattgaatcatatcag
gaatgtcaattagaaaatacggctgccataaatccgtattaattagaggactttttagtt
aaatggtcggattatgatcctcaaggtacaggttggataaccccagaagattttgcattt
ttgatgttcgaaataaatccccctctaggatttaaagatgaaaattctcaatattacgac
tttgctgctgcaaaaaatcaaaaattgaagtcccatttctataatcataagaaaaagatg
agactattcaaaactgagatctttcaaaaactaagtgattatcaagtgtaaatttatcaa
aataaaatggttcatttcaaggatatatgtatccagttggcttacaatgcaataaaaaag
aagaatgaactcaaaggaatcgaatagattgaagacaagatcattctacgttaaataaga
aaatcatgggagtccagatatcctgatttggttggaatgaaaacctaacaatttgttgta
gatatctttgcttttaattccatcactgacattttgagaggagttattgagaggaggaag
atcaagaaaagaatcaaggaaatgcaaaaggagaaaaacttaaagcaattagaaattaat
gaaaatgcttacatcaccaccaagactctgcttgaaagaaataaaggcagaagaaggagc
taaataagaaaaaaggtgtataacttctaataaaccaatgtctaaagaaggagtgaaatc
aatgttgatattgaacaagccatccatcaaccaaagagagctatgcatcaaaactactag
aaataataacaaaacaaggatgacaaaaattctttgactagtctaaacttttatattgat
cctgacgaaatgtgcaatggatttccaatgaaagttgtacatgaaactcaaaaaatcgat
tttcctgcaatcaaatctgataagagtttaggaactctctaagcgactcaaagtgaaaag
caagtcaagaaactaggagggtatatttcggaaaaatgctctgatgaagaaaatcaataa
gatagtgtaatataaaatttcaagagagacgatatgtttgaatga

DBGET integrated database retrieval system