KEGG   Paramecium tetraurelia: GSPATT00034839001Help
Entry
GSPATT00034839001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ptm  Paramecium tetraurelia
Pathway
Sulfur metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    GSPATT00034839001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     GSPATT00034839001
Transfer RNA biogenesis [BR:ptm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    GSPATT00034839001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 315 aa AA seqDB search
MLKVHEFFSIATQLAYNAAIIINQVRLSADIGQKWKGIDDPVTIADVKAQTYIVQQLHKH
WPQLKIVGEESTVYEQQIDMPDTFHNLYTEDIFSKTPSNLKVRTQYEIEDLCVWVDPLDG
TLDFVQGDFDCVTTLIGLSYKKQALMGIISQPFVKVADKQYEFKPKIYFGHHPQRRVFYT
YDTQSLIPFELLKPQYDPSNLTLCISKNRLNEETLQKIQSLGCPLLQMGGSGKKSLSILE
GKGDLYLYIGSKTSKWDICAPDALIQAFGGRFVGLEGQIYNYNHEDKNYNNPYGLLASIH
SDLVDKFLPRTTGML
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaagtacacgaattcttttcaattgccactcaattagcttacaatgcggcaata
attattaatcaagtccgattatcagctgatattggccagaaatggaaaggcatcgatgat
ccagtcactattgctgatgtcaaagcctaaacctatattgtgtagcaattgcataagcat
tggccataattaaagattgttggagaagaatccactgtctatgaatagcaaattgatatg
cctgatacttttcacaatctctatacagaggatattttcagcaaaacacccagtaatcta
aaggttagaactcaatatgaaatagaagatctatgtgtttgggttgatcctttggatggc
actcttgattttgtttagggtgactttgattgtgttaccaccttgattggtctctcatat
aaaaagtaagctttaatgggcatcatttcccaaccatttgttaaggttgctgataaacag
tatgaattcaaacccaagatatattttgggcaccatcctcaaagaagggtgttctatacc
tatgacactcaatcgttgattccctttgaactcttgaaaccataatatgatccttccaac
ctcactttgtgcatatcaaaaaacagattaaatgaagaaacattataaaaaatctaatct
ctcgggtgtcctctcctacaaatgggaggttctggcaagaagagtctttcaatcttagaa
ggtaagggagatttgtatctttatattggaagtaaaaccagcaaatgggatatctgtgca
cctgatgctctaattcaagcatttggaggtcgttttgtaggattagagggataaatttat
aattataaccatgaagataaaaattataataatccatatggccttttagcgagtattcac
agtgatctagtggacaaattcctgccaagaaccactggaatgttatga

DBGET integrated database retrieval system