KEGG   Paramecium tetraurelia: GSPATT00034842001Help
Entry
GSPATT00034842001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ptm  Paramecium tetraurelia
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:ptm03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 321 aa AA seqDB search
MAKDKQGEIDVDNIIERLLSVRGSKPGKNVNLTESEVRGLCIKARDIFISQPILLELEAP
LKICGDVHGQYFDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENF
FLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAALVDEKILCMHGGLSP
ELSNLEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWADNERGVSYVFSQEIVQVFLKK
HELDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGSMMTIDESLMCSFQILKP
AEQGAQGASQQNKPPSAKFVN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggataaatagggtgaaatagatgtggataacattattgaaagattactcagt
gtcagaggtagcaaaccaggaaagaatgtgaatctgactgaatctgaagttcgtggtctc
tgtataaaggctagagatatcttcatcagtcagccaattttgttagaattggaggcgcct
cttaaaatttgtggcgatgttcatggatagtatttcgatctcttgagattattcgaatat
ggtggttatccccctgagagtaattatctatttctgggtgactatgtggacagagggaaa
tagtcattggaaaccatctgtttacttctagcttacaaaatcaagtatcctgaaaacttt
ttccttctcagaggcaatcatgaatgcgcatccatcaatagaatatacgggttttatgat
gaatgcaagaggagatacacaattaaattatggaagactttcactgattgttttaattgt
ctacccgtggctgcattggttgatgaaaagattctttgtatgcatggaggactgtctcct
gaactctctaatttggagcaaatcaggaggattatgagaccgacggatgttcctgacact
ggtctcttatgcgatctgctgtggtcagaccccgataaagatgtctaagggtgggcagac
aacgagcgaggagtttcctatgtctttagttaggaaatcgttcaggtctttctcaaaaag
cacgaactcgatttgatttgcagagcccatcaggtggtggaggatggctacgagttcttt
agcaaacggcaattggtgactctcttctcagcgccgaattattgtggcgagtttgacaat
gccggctcgatgatgactattgatgaatccttaatgtgttcattccaaatactaaaacca
gctgaacagggtgcgtagggtgcatcctaataaaacaaacctccaagtgctaagtttgtc
aactga

DBGET integrated database retrieval system