KEGG   Paramecium tetraurelia: GSPATT00035109001Help
Entry
GSPATT00035109001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K18670  dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     GSPATT00035109001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   GSPATT00035109001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 APH Kdo DUF2634 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 5018811
NCBI-ProteinID: XP_001433026
Genoscope: GSPATT00035109001
UniProt: A0C4B2
Position
undetermined
AA seq 470 aa AA seqDB search
MSKFQQDGITICSLRGFQKWPSSAQHSFTPHKCGLRMVKQFTSHYKDYLQRFNGKPIQMP
VRILTSPKEGKYNDGYDNENHDLIIRQYDKLYNSKKNITYICEALLGAGTFGQVIKCSIE
GTKQQVAIKIIKNQCAFHQQQKIEIRVLRTLQTFSKEQNIQNNCIIQLNDQFLHKKHACL
VFPLMAQNLLEVMKTNKYEGFSVSLVRKFLNQIVTGLTVAEQCGVVHADLKPENIMIEQK
QPILDDCNLQIIDFGSSCFLNEKHPYIYIQSRFYRAPEIILENRNYTTKIDIWSLGCIAV
ELLLGSPLFPCWDQYSCLERIIQVTSPIITMQGYLKNASATSKYFNELQNETLQFKSREQ
FTAEFPQIQTKEGYNSTHPIKKLTDLAQYYNQQSTKDQPTFNQFLDFVQKCLEWEPSARM
SAQDASQHPFLTGQNQGFDINIDLEDLFAKLDTQSNQSSTSSFYEDQPEF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaattttaataagatggtataaccatctgttcactgagagggttccagaaatgg
ccttccagtgcccaacactccttcactcctcataaatgtggattaaggatggttaaataa
tttacgtcgcattataaggattatttatagagattcaatggcaaacctatttaaatgcct
gtgaggattcttacttctccaaaagaaggaaaatataatgatggttatgacaatgaaaat
catgatctcataatcagataatatgacaaattatacaacagcaaaaagaatataacatac
atttgcgaggctctcctaggtgcagggacatttggccaagtgatcaaatgtagcatagaa
ggaacgaaacaataagttgcaataaagatcataaaaaattaatgtgcatttcatcaataa
caaaagatagaaattcgtgtattaagaactctctaaacattctcaaaagaataaaatatt
taaaacaattgtataatccaactaaatgattaatttttacacaagaaacatgcttgctta
gttttccctttgatggcacagaatttgcttgaagtgatgaaaacaaataaatatgaagga
tttagcgtgtcgctagtccgaaaatttctcaatcaaatagtgacaggactcacagtggct
gaacaatgtggagttgttcatgctgatctgaagccagagaatataatgattgaacaaaag
cagcccatattggatgattgtaatctgtaaatcattgactttggatccagttgctttttg
aatgagaaacatccttacatctacattcaaagtagattctacagggctcccgaaataatt
ttagagaatcgcaattacacaactaaaatcgatatctggagtttgggatgcatcgcagta
gaattgttattgggcagtcccctttttccatgttgggaccaatactcttgtttggaacga
atcattcaagtgacgagtcccatcataactatgcagggatatttgaaaaatgcctctgca
acatcaaaatacttcaacgaactctaaaatgagactttgcaattcaaatccagggagcaa
ttcacggctgaatttccttaaatctaaaccaaggaggggtacaactcaactcatccgatc
aagaaactcacagatctagcgtaatattataactaataatctaccaaagactaacccaca
ttcaatcaatttctggacttcgtgtagaaatgtcttgaatgggaaccaagtgctaggatg
tctgcctaggatgctagttaacacccatttttgacgggacaaaactaaggatttgacatc
aatattgatttagaggacttgtttgcgaaattggatacttaatctaattaaagtagtact
tcctctttttatgaagaccaaccagagttctga

DBGET integrated database retrieval system