KEGG   Paramecium tetraurelia: GSPATT00035895001Help
Entry
GSPATT00035895001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
ptm  Paramecium tetraurelia
Brite
Exosome [BR:ptm04147]
 Exosomal proteins
  Proteins found in most exosomes
   GSPATT00035895001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 156 aa AA seqDB search
MSWDAYVTNLTANGALEYAAIIGTDGNIWASNFGVAALPSYQAEVPDEKNPDITTKVAYD
EKAAFIHALAHKGETGNPAGVRINNQKYYTIQFDGENKSWYLKKNKGGACVAWTNSAVVF
ASFSQTINAENGAPQNASDCNKRVLDMAKYLADSGY
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggatgcttatgtgactaacttgacagccaatggcgcgcttgaatatgctgcc
atcattggaacagatggaaacatctgggctagcaatttcggagttgccgccctcccatct
tattaagccgaagtgccagatgagaaaaatccagacatcacaaccaaagttgcttatgat
gaaaaggctgcttttattcatgctctcgctcacaaaggagagacaggaaatccagctgga
gttagaatcaacaaccaaaagtattacacaatataatttgatggagaaaacaagagctgg
tacttaaagaagaataaaggtggagcttgtgttgcttggaccaattcagctgttgtcttt
gcttcattctcccaaaccatcaatgctgaaaatggagcaccttagaatgctagcgattgc
aacaaacgtgtccttgatatggcaaagtaccttgctgattccggatattga

  All links  
No link information was found.   
DBGET integrated database retrieval system