KEGG   Paramecium tetraurelia: GSPATT00036828001Help
Entry
GSPATT00036828001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ptm  Paramecium tetraurelia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GSPATT00036828001
Enzymes [BR:ptm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GSPATT00036828001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSPATT00036828001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 728 aa AA seqDB search
MQYIDQGSALSNKNVPGRRLQKKNSLFYQVTPLQIEQQAVLENEEFTQRYQKNADELQVF
KDDPYLEPHKQHFSVRNAKFFELLEQIVKVESSLKDFAKGYEKYGFQVSDTGITYKEWAP
GAKEVYLTGDFNNWDKMQYSLTSDSFGNWEIFLPRNEDGSYLIPHGSRVKTYIKDANNQY
QFKIPAWIRTTWQNQDNKLYDGVFYNPENKYEFKSNRPPKPRCLKIYEVHIGMAGIDPRV
HTFKEFTQTVLPRVVKLGYNVIQIMAIQEHAYYGSFGYHVTNFFAVSSRFGSPDDLKELI
DTAHSHGITVLMDLVHSHASSNVLDGINQWDGTDYQYFHAGGKGKHDLWDSKLFDYSKWE
VIRFLLSNLSWWINEYQFDGFRFDGVTSMLYVHHGNGYGFTGGYHEYFNELADIDSLVYL
MLANDLIHEIHPNAITIAEDVSGYPTLCRNIKEGGIGFDYRMAMAVPDKWIKLLKEFKDD
DWDMGDIAHTLTNRRYLEKCICYAESHDQALVGDKTLSMWLFDKEIYSEMSTLQPETLVT
FRGMALHKMLRLITFALGGEGYLNFMGNEFGHPEWIDFPREGNGWSYHHARRRWDLADDQ
FLRYSRLLQFDAEMINLEDKYPWLPNGEQWVTEKHNESKVIIFERGSLLFVFNFHPTQSY
EHFKVGTKFESDHQIVLDTDDVRFGGHSRVSPSYGQNFPILKEEWQGRPNHIQIYLPNRC
AIVFKSIE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatatcgattaaggaagtgctctttctaataaaaatgtcccaggcagaagactt
caaaagaagaactccctcttctatcaagtaacaccattgtaaatagaatagcaagccgtg
ttagaaaatgaagagtttacacaacgctaccaaaagaatgccgatgaattgcaagtattc
aaggatgacccttaccttgaaccccacaaatagcacttctcagtaaggaacgcgaaattc
ttcgaactacttgaatagattgtcaaagtggagtcatctctgaaagattttgccaaggga
tacgaaaaatatgggttttaggtctcagacactggaattacatataaagaatgggctcct
ggggcgaaagaagtttatttgactggtgatttcaataattgggataaaatgcaatattct
ctaacttcagattcttttggaaattgggaaatatttttacccagaaatgaagacggctcc
tatttgataccacacggttcacgagtcaagacatacataaaggatgccaataatcaatac
taattcaaaattccagcatggattcgaactacttggtagaatcaagacaataaattatat
gacggagtattttataatcccgaaaacaaatacgagtttaagtccaacagaccaccaaag
cctagatgtcttaaaatatatgaggtacatatcggaatggctggtattgatccaagagta
cacaccttcaaagaattcacccaaacagttctcccaagagtagtcaaactgggatacaat
gtcatctaaataatggcaatacaagaacatgcctattatggaagctttggataccatgtt
accaacttctttgctgtcagcagcagatttggcagtccagatgacttaaaagagttgatt
gatacagcacattcccatggaattactgtgttgatggacttagttcatagtcatgcatcc
agtaatgttttagatggcattaatcaatgggatggcaccgattatcaatatttccatgct
ggtggtaaggggaaacatgatttgtgggattctaaactatttgattattctaaatgggaa
gtgataagatttctattatccaatttgtcctggtggattaacgaatattaatttgatggc
tttagatttgatggtgttacatcgatgttatatgttcatcatggaaatggctatggtttc
acaggaggatatcatgaatactttaatgaattagctgatatcgattcattagtgtatttg
atgttggcaaatgatctcatacatgaaattcatcctaatgcaattacaatagctgaagat
gtgtctggttatccaacattgtgccgtaatattaaagaaggtggaattggatttgattac
agaatggctatggctgttcctgataaatggattaaattacttaaggaatttaaagatgat
gattgggatatgggagatatcgctcatactcttaccaatagacgttatttagaaaaatgt
atatgttatgctgaatctcatgactaagccttggtgggagacaaaactctctccatgtgg
ctctttgacaaggaaatttatagtgaaatgagtactctttagccagaaactttagtcact
tttagaggcatggctttacataagatgttgagattgattacatttgcattaggtggagaa
ggatacttaaatttcatgggtaatgaatttggacatcctgaatggattgattttccaaga
gaaggtaatggatggagttatcatcacgccagaagaagatgggatttagctgacgattaa
ttcttaagatattctagactcctgtaatttgatgctgaaatgatcaacctagaggataaa
tatccctggttgcctaatggtgaataatgggtgactgaaaaacacaatgaaagcaaagtt
attatatttgaaagaggatccttactctttgtatttaatttccaccctacttaatcatat
gaacattttaaggtgggcactaaatttgagtcagatcaccaaattgttttagatactgat
gatgttagattcggagggcactcgagggtatcaccgtcttatggtcagaatttcccaatc
ttaaaggaagaatggcaaggcagacctaatcatatccaaatatatttaccaaatagatgt
gctatcgtttttaaatcaattgagtga

DBGET integrated database retrieval system