KEGG   Paramecium tetraurelia: GSPATT00037598001Help
Entry
GSPATT00037598001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ptm  Paramecium tetraurelia
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSPATT00037598001
   01212 Fatty acid metabolism
    GSPATT00037598001
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GSPATT00037598001
   00650 Butanoate metabolism
    GSPATT00037598001
  Lipid metabolism
   00062 Fatty acid elongation
    GSPATT00037598001
   00071 Fatty acid degradation
    GSPATT00037598001
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GSPATT00037598001
   00310 Lysine degradation
    GSPATT00037598001
   00380 Tryptophan metabolism
    GSPATT00037598001
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GSPATT00037598001
Enzymes [BR:ptm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GSPATT00037598001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 266 aa AA seqDB search
MFRKSLFRFSTYNFISVTQKGKVALIQLNRPKALNALCDGLIKELNQVTQEIDANPEYGS
IVITGNEKAFAAGADIKEMQDKSFPQVQNIQMLASWENLTNIKKPILAAVNGYALGGGFE
LALMCDIIYAGENAKFGLPEITLGTIPGCGGTQRLIRAVGKSKAMEMTLTGEFIDAQTAL
SYGLVSKVVPAQNLVEETLKVAEKIASFSKPVAALIKDTINEAENIGLREGVKYERKAFY
STFATQDRKEGMSAFVEKRKPSWTDN
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggaaatcattgttcagatttagcacatacaatttcatcagtgttacacaaaaa
ggaaaggtcgccttaatttaattaaacagaccaaaagctttgaatgctctttgtgatgga
ttaattaaagaattaaaccaagtaacataggaaattgatgctaatcctgaatatggatca
attgtgattacaggaaatgaaaaagcatttgcagctggagcagacattaaagaaatgtaa
gacaaatctttcccataagttcaaaacatctaaatgcttgcatcatgggaaaacttgacc
aatattaaaaagcctatccttgcagcagtaaatggttatgccttaggtggtggatttgaa
ttggcattaatgtgtgatattatttatgcaggagagaatgctaaatttggattgcctgaa
attacacttggaacaattccaggatgtggaggaacttaaagattaattagagcagtaggc
aaatcaaaggctatggaaatgacattaacaggagaattcattgatgcacagactgcactc
tcatatggattagtcagcaaagtagttccagcataaaatttagttgaggaaacattaaaa
gtggctgaaaagatagcttcatttagcaaacctgttgctgctttgatcaaggacaccata
aacgaggcagaaaacattggattaagagaaggagtgaaatatgaaagaaaagcattctat
tctacattcgcaactcaagacagaaaagagggaatgtcagcatttgtagaaaagagaaaa
ccatcttggactgataattga

DBGET integrated database retrieval system