KEGG   Paramecium tetraurelia: GSPATT00037598001Help
Entry
GSPATT00037598001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00062  Fatty acid elongation
ptm00071  Fatty acid degradation
ptm00280  Valine, leucine and isoleucine degradation
ptm00310  Lysine degradation
ptm00380  Tryptophan metabolism
ptm00410  beta-Alanine metabolism
ptm00640  Propanoate metabolism
ptm00650  Butanoate metabolism
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
ptm01212  Fatty acid metabolism
Module
ptm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GSPATT00037598001
   00650 Butanoate metabolism
    GSPATT00037598001
  Lipid metabolism
   00062 Fatty acid elongation
    GSPATT00037598001
   00071 Fatty acid degradation
    GSPATT00037598001
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GSPATT00037598001
   00310 Lysine degradation
    GSPATT00037598001
   00380 Tryptophan metabolism
    GSPATT00037598001
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GSPATT00037598001
Enzymes [BR:ptm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GSPATT00037598001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 5022343
NCBI-ProteinID: XP_001436558
Genoscope: GSPATT00037598001
UniProt: A0CEE4
Position
undetermined
AA seq 266 aa AA seqDB search
MFRKSLFRFSTYNFISVTQKGKVALIQLNRPKALNALCDGLIKELNQVTQEIDANPEYGS
IVITGNEKAFAAGADIKEMQDKSFPQVQNIQMLASWENLTNIKKPILAAVNGYALGGGFE
LALMCDIIYAGENAKFGLPEITLGTIPGCGGTQRLIRAVGKSKAMEMTLTGEFIDAQTAL
SYGLVSKVVPAQNLVEETLKVAEKIASFSKPVAALIKDTINEAENIGLREGVKYERKAFY
STFATQDRKEGMSAFVEKRKPSWTDN
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggaaatcattgttcagatttagcacatacaatttcatcagtgttacacaaaaa
ggaaaggtcgccttaatttaattaaacagaccaaaagctttgaatgctctttgtgatgga
ttaattaaagaattaaaccaagtaacataggaaattgatgctaatcctgaatatggatca
attgtgattacaggaaatgaaaaagcatttgcagctggagcagacattaaagaaatgtaa
gacaaatctttcccataagttcaaaacatctaaatgcttgcatcatgggaaaacttgacc
aatattaaaaagcctatccttgcagcagtaaatggttatgccttaggtggtggatttgaa
ttggcattaatgtgtgatattatttatgcaggagagaatgctaaatttggattgcctgaa
attacacttggaacaattccaggatgtggaggaacttaaagattaattagagcagtaggc
aaatcaaaggctatggaaatgacattaacaggagaattcattgatgcacagactgcactc
tcatatggattagtcagcaaagtagttccagcataaaatttagttgaggaaacattaaaa
gtggctgaaaagatagcttcatttagcaaacctgttgctgctttgatcaaggacaccata
aacgaggcagaaaacattggattaagagaaggagtgaaatatgaaagaaaagcattctat
tctacattcgcaactcaagacagaaaagagggaatgtcagcatttgtagaaaagagaaaa
ccatcttggactgataattga

DBGET integrated database retrieval system