KEGG   Paramecium tetraurelia: GSPATT00038372001Help
Entry
GSPATT00038372001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
ptm  Paramecium tetraurelia
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    GSPATT00038372001
Exosome [BR:ptm04147]
 Exosomal proteins
  Proteins found in most exosomes
   GSPATT00038372001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 1690 aa AA seqDB search
MNPIRPIRVQEAYRFSQLGVSQTNFKFGQIFFESDKYITIRETAPNGDTQLLQFNFETKQ
LISRKPNKADSALMHPEKNIIALRAAGEQPNSTVIQIFNLDEKQRIKNVELNETIVFWRW
VNPQKLAYVTPTAVYHINITNPNEQQVKVMDRYPLSLENPVQIIGYGLEGNEKWCALYGI
STPDGGRTINGHIQLFLIEQARQQILEGHCCCFGDALIHTDDYKSSLFCFVERKSGETTS
RLHITEIGVPPNGFQKYKRQVEVQTDPNYPTDFPVLMHINQKYGLIYVISKFSFLTVYEL
STASLIFRERICNENVFVGAPNINQGQYHIIGKEGIVYTISVNDDQLVSYLINTCRHIPD
VIQLGFRLASRYKLPGADNMFVDQFNKAILSGDALSAAKIAASAPGTVLRNPERQPQPLI
VYFQTLLEKGTLNKFEAIELCGPILQQGRKQFVEQWIAQNKLEPSDELGDLLKRYDANLA
IQIYKQSKSYQKLAQCYMETGQLELAMQLQQQFGVSTDYMAMLRNMMMQSPEQALAMAKS
LYQRDQSINVHQIAELFEQFQRLPEMTAFLVECMKNNRAEDGPLQTKVLCLNLQAAAQVA
DAILQMNIWTQFDRIRVAQLCEQKGLYQRALENYSDPKDVKRVILNTHALPPEFLVNFLS
RVDPALTLQCLQDLLRHNRQNLQVVVNLALKSFESVSAFEGVYLFLGSLINTTSDKDIYY
KYIEAAAKCNQIKELERVITEKGDCYDADKVKNYLKEQKLSDPRPLIFLCDMNGFVDELT
RYLYKNGFTRYIEIYIFKVNPNAAPGVFGTLIDLECDEVYLKQLLYNIRGMCPIEPTVDE
FEKRNKLRVLEQWLEARVTEGNQIPAIHNALAKIKIDTSQDPDGFLINNQFYDAKAVGKF
CEERDPQLAVLAYKRAWGQCDQELINLTNKNEMYRVQAKYLVERQDVDLWAGVLQETNPH
RKNLIDYVIQALQDSKNVDEVQAAVKAFVLAKIPYELLGLLEKLVLHNPEFMQYKQLQNL
LIITAIQSDTSKVLDYINRLDKFDPQIIAQHCLNEEYNLFEEAYAVFKKFNLHIDAVNVL
LRNLGSIPRAHEYAQYASSPEVWSLLAEAYLNQGQTNESIDCYIKANDSSAFLNIINVAE
QEEKYELLVKYLLMCRQTVKDVNIDNSLIYCYAKLDKNLDVESLIQSSNSADVIKVGERC
YDQQLYEAAKILFTALKNNARIASCLVRLKQFNKAIEAAQKANTSKTWKELCFACVEASE
FKYASIAAQNIIIVPDMLESLIKQYEEYNAQEEMMILLENALGMQRAHVGIFTELAVLYC
HYKQKKVMEHCRQYFQKMNILKVLRTCEKMCLWSEAVYLHQHYDQPDNAINIMIEHSPTA
FSHDVLVMLLQKITNTDLYYKCILFYLEEQPEQINDLLRSIQSKIDLSKFVKLMKNTGYL
ALTLPFLQQIQNANNKDVNDALNQLYLDIEDYENLRESVKNYENFDQLALAQKTQSHELV
EFRRIAAYLYRKIQKYDLSMNLSKQDQMYRDAIETAQESQNVKLVYELLEFFIQNKESEF
FTVCLYTCYDLLKPDQVMELTWRSGLMEFAMPYFIQITWELTHKIEYVQKKHEDREKKEI
QTAQQQQSQALPIAQDFLLNQGQLMLGPPSQMSSSNLGFGQSSGFTNSQMNQAPMGYGGQ
QFGSYQPPGF
NT seq 5073 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaataagaccaataagagtttaagaggcataccgattttcttaattgggtgtt
agtcaaaccaatttcaagtttggttaaatattcttcgaatcagataaatatatcacaatc
agagagacagccccgaatggagatactcaattattgcaattcaattttgagacaaagcaa
ttgatttctcgtaagccaaacaaggcagactctgctttaatgcatccagaaaagaatatc
atcgctcttagagctgcaggggaatagccaaattcaactgtgatctaaatcttcaatttg
gatgagaagtaaagaataaagaatgtcgaattgaatgagactatagtgttttggagatgg
gtcaacccataaaaattagcatatgttactccaacagcagtatatcacatcaatatcaca
aatcccaatgagcaacaagtcaaagtgatggacaggtatccattgtcattagagaatcca
gtgtaaatcataggatatggattggaaggaaatgaaaaatggtgtgcattatatggtatt
tcaacaccagatggaggtagaacaattaatggtcacattcaattatttttgattgaatag
gcaaggtaataaatcttagaaggacattgttgttgttttggagatgccttgattcacaca
gatgactacaaaagcagtttattctgttttgtggagagaaagtctggtgaaacaacaagc
agattacacatcacagaaattggagtaccacccaatggattctaaaaatacaaaagataa
gttgaagtttaaactgatccaaattatccaacagatttcccagtcttaatgcacattaat
caaaaatatggattgatctatgtaataagcaaattttcatttttgactgtctatgaatta
agcactgccagtttgatattcagagagagaatctgcaacgagaatgtctttgtaggtgcc
ccaaacattaatcaaggataatatcatattattggtaaggaaggtattgtctacacaata
tctgttaatgatgactaattggtgtcttacttaattaacacttgcagacatattccagat
gttattcaattgggattccgtttggccagtagatataagcttcctggagcagataatatg
tttgtagatcaattcaataaggccatcttatctggagatgctttgagtgctgctaaaatt
gctgccagtgctcctggtacagttcttagaaacccagaaagataaccataaccactcatc
gtctatttccaaacattattagaaaagggaacattgaataaatttgaagctatcgaattg
tgtggaccaattttataacaaggaagaaaacaattcgttgaatagtggattgcataaaat
aaattagaaccatcagatgaattaggagatctcttaaaaagatatgatgccaatttagct
attcaaatctacaaataatctaaatcatactagaaattagcataatgctatatggaaact
ggatagctagaattggctatgcaattacaataacaatttggagtatcaacagattacatg
gctatgttgagaaatatgatgatgtaatctccagaacaagccttagctatggccaaatct
ttatatcaaagagaccaaagcatcaatgttcatcaaattgctgaattatttgaataattc
tagagattaccagaaatgacagccttcttggttgaatgcatgaaaaacaacagagctgaa
gatggaccactctaaactaaagtcttatgcttgaacttataggctgctgcataagttgcc
gatgccatcttataaatgaacatctggacccaatttgatagaattagagttgcccaatta
tgtgaataaaaaggactttatcaaagagcacttgaaaattattcagatccaaaggatgtt
aaaagagttattcttaatactcatgctctccctcctgaattccttgtcaatttcttatcc
agagttgatcctgcattgacattataatgcctttaagatttattaagacacaatagatag
aatctataagttgttgtcaatcttgcattaaagtcttttgaatctgttagtgcatttgaa
ggagtctacctatttttgggatctttgattaacacaacatctgataaggatatctattat
aaatatatcgaagctgctgctaaatgcaattaaatcaaagaattagaaagagttattaca
gaaaaaggagattgttatgatgctgataaagtcaaaaattacttaaaggaataaaagtta
tctgatccaagaccattgatattcttatgtgatatgaatggatttgttgatgaattgacc
agatatctttataaaaatggattcactagatatattgaaatctatatcttcaaagttaat
cctaatgctgctcctggtgtatttggtacattaattgatttggaatgcgatgaagtttac
ttgaaataattgttgtataacatccgtggaatgtgtccaattgaaccaactgttgatgaa
ttcgaaaaaagaaataaacttagagtcttagaataatggcttgaagctagagttacagaa
ggcaaccaaattccagctattcacaatgcattagccaaaatcaagattgatacatcataa
gatcctgatggtttcttgatcaataatcaattctatgatgcaaaggctgttggtaaattc
tgtgaggaaagagatccttaattagcagttctagcttacaagagagcttggggacaatgc
gattaagaattaattaatttaacaaacaaaaatgaaatgtacagagtctaagccaaatat
ctcgtagaaagataggatgttgatttatgggctggagtattataagagacaaatccacac
agaaaaaatttaattgactatgtcatttaagcattacaagactcaaagaatgttgatgaa
gtttaagcagctgtcaaagcatttgtgttggccaagattccttatgaattattgggtttg
ttggagaaattggttttacataaccctgaatttatgtaatacaaataattatagaattta
ttaatcatcacagccattcaaagtgacacaagcaaagtgttggattacatcaatagattg
gataaattcgatccataaattattgcttaacattgtttgaatgaagaatataacttgttt
gaagaggcttatgctgtctttaagaaatttaatttacacattgatgctgttaatgtatta
ctcagaaatttgggaagcattccaagagctcatgaatatgcttagtatgctagttcccca
gaagtatggtcattattggctgaagcttatttgaattaaggataaacaaatgaatcaatt
gattgctacatcaaggctaatgattcaagtgcattcttgaatattattaatgttgctgaa
taagaagagaaatatgaattattagtcaaatatctcttaatgtgcagataaacagtcaag
gatgtcaacattgacaattcattaatctattgttatgcaaaattagacaagaacttagat
gttgaatctttgatttaatcaagcaactcagcagatgtaattaaggtaggagagagatgc
tatgatcaataattatatgaggcagctaagatcttgttcactgcccttaaaaataatgca
agaatagcatcttgtttggttagattaaaataatttaacaaagctattgaagcagcttaa
aaggccaatacttccaagacatggaaagaattatgctttgcttgtgttgaggcatcagaa
ttcaagtatgcttcgattgctgcttagaatattatcattgtaccagatatgttggagtca
ttgataaaataatatgaagaatacaatgcataagaggaaatgatgatattattggagaat
gccttaggtatgtaaagagcacatgttggtatcttcacagaattagcagttctttattgc
cattacaaatagaagaaagtcatggaacactgcagataatacttctagaagatgaacatt
ttgaaagtcttaagaacttgtgaaaagatgtgtctctggagtgaagctgtctacttacat
caacactatgattaaccagataatgctatcaacattatgatcgagcattcaccaactgcc
ttctcacatgatgttctagtcatgttactctaaaagattaccaatacagatttgtattac
aaatgtattctcttttaccttgaagaataaccagaataaattaatgatttattgagaagc
attcaatctaagatcgatttaagcaaatttgttaaattgatgaagaacactggctatttg
gctttgacattaccatttttataacaaatccaaaatgccaataacaaagatgttaacgat
gccttgaatcaactctatttagatattgaggactatgaaaatcttagagaatcagtcaag
aactatgaaaactttgactaattggctttggcataaaagacctaatctcacgaattagtt
gaattcagaagaatcgctgcttatttatatagaaagatttagaaatatgatttatcaatg
aacttgagtaaataagactaaatgtacagagatgccatcgaaactgcttaagaatcttag
aatgttaagttagtctatgaattattggaattcttcatatagaataaggagagcgagttc
tttacagtgtgtctttacacatgctatgatttattgaaaccagactaagttatggaattg
acctggagatcaggccttatggaatttgctatgccatacttcatctaaatcacttgggaa
ttgactcacaagattgagtatgtataaaagaagcacgaggacagagaaaagaaggaaatt
caaactgcataataacaataatcataagccttaccaatagcttaagatttcctattgaac
taaggttaattaatgttgggtccacccagctagatgagtagtagcaatttaggttttgga
tagtcttcaggttttacaaattcctaaatgaattaagctcctatgggttatggaggataa
caatttggatcatactagccaccaggtttttga

DBGET integrated database retrieval system