KEGG   Paramecium tetraurelia: GSPATT00038399001Help
Entry
GSPATT00038399001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ptm  Paramecium tetraurelia
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ptm04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 483 aa AA seqDB search
MKSLILISLLLATSLCAFQEEDNVLVLTTDTFQDAIDTFKFIMVEFYAPWCGHCKKLAPE
YSAAAAELKKIGGDNYVPLAKVDATAEASVAEKFSIQGYPTIKFFISGQAIDYEGGRTTN
EIVAWINKKSGPPSTELNTVEDIEKFLERVSSTPILVYFGSTTDNNDYNTFIELAQQNDK
VTFAHTLNLELAEKYNVRGKIVLFKSFDEKRNDFDQSVTLPNLESFINSYANPILLPFND
KAINIVFQQRNNAVILFTDDSDAGVAAFDAFAAVAGSFKDRIKFSYSKPNDGSGLFHRLA
EYIGASTTNVPNVMLYDQLGGNGKYRFEGEITTESLRTFLTNFFDGSLTRYMKSEEVPAT
NDEPVKIVVGKNFKDLVLNNDKDVLIEFYAPWCGHCKQLAPIYEGLAKKLLVNPNIIIAK
CDATANEIEGVNIESFPTIKFWKNGQKNQIIDYSSGRDEANFISFLKENTSHQWVDLDRV
EEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattgatattaatcagcttgttattagctacatctttgtgtgcattctaagaa
gaggataatgtattggtgttaacaacagatacattttaagatgctatcgatactttcaaa
ttcataatggttgagttttatgcaccctggtgtggacattgcaagaagttggctcctgag
tattctgctgcagctgctgaattgaaaaagattggaggagacaattacgtgcctttggca
aaggttgatgctacagctgaagcatcagtggctgaaaaattctccatctaaggatatcca
acaataaaattcttcattagtggtcaagcaattgattatgaaggaggaagaacaacaaat
gaaattgttgcttggattaacaagaaatcaggacccccatctacagaattaaatacagtc
gaagacatcgaaaaattcttagaaagggtatcaagtactccaattcttgtctattttgga
tcaacaacagacaataatgattataataccttcattgaacttgcataatagaatgataaa
gttacattcgcacacaccttaaatttagaattagctgagaaatacaatgttagaggaaag
atagtcctcttcaaatccttcgatgagaagagaaacgattttgattaatcagtgacatta
cctaacttagaaagtttcataaatagctatgctaatccaatcctcttaccattcaacgat
aaagcaatcaacatcgttttctaatagagaaacaacgccgtcattttattcacagatgat
tctgatgctggtgttgctgcattcgatgccttcgctgccgttgccggttcattcaaagat
agaatcaaattctcatactccaaaccaaatgatggatcaggtttattccacagattagct
gaatatattggtgccagcactactaatgttcctaatgtgatgttatatgactaattggga
ggaaatggtaaatacagattcgaaggtgaaatcacaactgaatcattaagaaccttctta
acaaacttctttgacggatcattaacaagatatatgaaatcagaagaagtacctgctacc
aatgatgaaccagttaagattgttgttggcaaaaacttcaaagatttagtcctcaataat
gataaggatgttttgattgaattctatgctccttggtgtggtcattgcaaacaattggct
ccaatttatgaaggtttagctaagaaattgttagttaatccaaatatcattattgctaag
tgtgatgctacagctaacgagattgaaggtgtcaatattgaatcattcccaacaatcaaa
ttctggaagaatggataaaagaattaaatcatagattatagcagtggaagagatgaggcc
aacttcatttccttcttaaaagaaaacacttcacattaatgggttgatcttgatagagta
gaagaattatga

DBGET integrated database retrieval system