KEGG   Paramecium tetraurelia: GSPATT00038399001Help
Entry
GSPATT00038399001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ptm  Paramecium tetraurelia
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GSPATT00038399001
Enzymes [BR:ptm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GSPATT00038399001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   GSPATT00038399001
  Exosomal proteins of colorectal cancer cells
   GSPATT00038399001
  Exosomal proteins of bladder cancer cells
   GSPATT00038399001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 483 aa AA seqDB search
MKSLILISLLLATSLCAFQEEDNVLVLTTDTFQDAIDTFKFIMVEFYAPWCGHCKKLAPE
YSAAAAELKKIGGDNYVPLAKVDATAEASVAEKFSIQGYPTIKFFISGQAIDYEGGRTTN
EIVAWINKKSGPPSTELNTVEDIEKFLERVSSTPILVYFGSTTDNNDYNTFIELAQQNDK
VTFAHTLNLELAEKYNVRGKIVLFKSFDEKRNDFDQSVTLPNLESFINSYANPILLPFND
KAINIVFQQRNNAVILFTDDSDAGVAAFDAFAAVAGSFKDRIKFSYSKPNDGSGLFHRLA
EYIGASTTNVPNVMLYDQLGGNGKYRFEGEITTESLRTFLTNFFDGSLTRYMKSEEVPAT
NDEPVKIVVGKNFKDLVLNNDKDVLIEFYAPWCGHCKQLAPIYEGLAKKLLVNPNIIIAK
CDATANEIEGVNIESFPTIKFWKNGQKNQIIDYSSGRDEANFISFLKENTSHQWVDLDRV
EEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattgatattaatcagcttgttattagctacatctttgtgtgcattctaagaa
gaggataatgtattggtgttaacaacagatacattttaagatgctatcgatactttcaaa
ttcataatggttgagttttatgcaccctggtgtggacattgcaagaagttggctcctgag
tattctgctgcagctgctgaattgaaaaagattggaggagacaattacgtgcctttggca
aaggttgatgctacagctgaagcatcagtggctgaaaaattctccatctaaggatatcca
acaataaaattcttcattagtggtcaagcaattgattatgaaggaggaagaacaacaaat
gaaattgttgcttggattaacaagaaatcaggacccccatctacagaattaaatacagtc
gaagacatcgaaaaattcttagaaagggtatcaagtactccaattcttgtctattttgga
tcaacaacagacaataatgattataataccttcattgaacttgcataatagaatgataaa
gttacattcgcacacaccttaaatttagaattagctgagaaatacaatgttagaggaaag
atagtcctcttcaaatccttcgatgagaagagaaacgattttgattaatcagtgacatta
cctaacttagaaagtttcataaatagctatgctaatccaatcctcttaccattcaacgat
aaagcaatcaacatcgttttctaatagagaaacaacgccgtcattttattcacagatgat
tctgatgctggtgttgctgcattcgatgccttcgctgccgttgccggttcattcaaagat
agaatcaaattctcatactccaaaccaaatgatggatcaggtttattccacagattagct
gaatatattggtgccagcactactaatgttcctaatgtgatgttatatgactaattggga
ggaaatggtaaatacagattcgaaggtgaaatcacaactgaatcattaagaaccttctta
acaaacttctttgacggatcattaacaagatatatgaaatcagaagaagtacctgctacc
aatgatgaaccagttaagattgttgttggcaaaaacttcaaagatttagtcctcaataat
gataaggatgttttgattgaattctatgctccttggtgtggtcattgcaaacaattggct
ccaatttatgaaggtttagctaagaaattgttagttaatccaaatatcattattgctaag
tgtgatgctacagctaacgagattgaaggtgtcaatattgaatcattcccaacaatcaaa
ttctggaagaatggataaaagaattaaatcatagattatagcagtggaagagatgaggcc
aacttcatttccttcttaaaagaaaacacttcacattaatgggttgatcttgatagagta
gaagaattatga

DBGET integrated database retrieval system