KEGG   Paramecium tetraurelia: GSPATT00038867001Help
Entry
GSPATT00038867001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 736 aa AA seqDB search
MGIIQDFNKQNFGCLKLSKTYIQELNIMITKLQLTVFSMFLNFMLQQFLNMGFTQQQILK
AQQICKQYRNLEILDVLLKNVQSPIKDQSQQQSQSQILRELSFDVLTPDQRLRQKGIPVG
LKNLANVCYLNSLVQTYFHNPIFVKEILSFKYPVQLNFEDLLNKNEAKAKRIKSSIDLVV
HLQRFQKINIFRLFAYLVHTDRKYVDPYRVFLNVVDEFGNRFQLGDQKDWAEFNLQFITC
IDEGLKYHENKIMDAEMQNKDESGDMHESDQYQNDRNKSGITQTRSMILLDENKAKLIEQ
QPLQSQPQNQTIINRLFFGKTKEYITHPNQRNQSEEQEQIFLQIILNVKNKSLYQAWEAN
NSFSIEGYRNGSEVIELAEKAIWITQIPDSLLFQIQRVGYDPERGLIKLNDEFRFEKEIY
ADRFLLENRQKVIETQQQLIELKIKQAELLFQMDKYQNYNGISMLTVLSTATKYVKEAKP
DDEIMQQRIEQCRLSIQLILQKHQFELDEINQKIEDLYAIMKKYKYFLQSILIHEGAAES
GHYYTYIYNPSLKHWFKFNDINVTQVSEEKVLRDAYGDGKSKTNAYCLIYQRADHFEPQS
YSDYTNNSVYAQYIQQNLYEEVKNDNKKFSIEQQEHELVELGDLVVEIYNVQFQQVNEMA
RKFKYRNGNPLNNFPTYLRTLLDQMNDLVKWSILDYAIREASQGKRNLRDYQEQMIFQQR
CISIILILESNTILNN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcatctaagattttaacaaataaaactttggatgtttgaaattatctaaaaca
tatatataagagttgaatataatgattacgaaattgcagttgacagtgttttctatgttt
ttaaattttatgttgcaataattcttgaatatgggattcactcagtaatagattttgaag
gcttaacaaatttgcaagtaatatagaaacttagagattttggatgtgcttctgaaaaat
gtttagtctccaataaaagattaatctcaataacaatcccaatcccagattttgagggaa
ttgtcatttgatgttttgactcctgatcaacgattgcgataaaagggaatacctgtagga
ttgaaaaatttggctaatgtttgctatttgaattctctggtttagacatattttcataac
ccaatctttgtgaaggagatattgagctttaaataccctgtgcaattgaatttcgaggat
ctcttaaacaagaatgaggcaaaagcaaagagaataaagtcatcaatcgatttagttgtg
catttgtagaggtttcaaaaaataaatatttttagactgtttgcttacttagttcacaca
gatagaaagtacgttgatccatacagagtgttcttgaatgttgtagatgagtttggtaat
aggttttaattgggggattaaaaggattgggcggaattcaatttataatttataacatgc
attgacgagggattgaaatatcatgagaataaaataatggatgctgaaatgtagaacaaa
gatgaaagtggggacatgcatgaatcagattagtattagaatgatagaaacaaatctgga
attacttaaacaagatctatgatactattggatgagaacaaggccaaattgatagaataa
cagccattgcaatcataaccttagaattagacaataatcaatagattattttttggaaaa
accaaagagtatatcacacatcccaatcagagaaatcagagtgaagaacaggagtaaata
ttcttgtagattatattgaatgtgaagaacaagagtttatattaagcttgggaagcaaac
aattccttttcaatagaaggatatcgtaatggaagtgaagtgattgagttggctgagaaa
gctatttggattacttagattcctgattccttgttattccaaatataaagagtggggtat
gacccagagagaggattgatcaaattgaatgatgaatttcgatttgagaaggagatctat
gcagatagattcctcttggagaacagatagaaggttatcgaaacacaatagcaattaatt
gaactcaaaattaaataagctgaattattgtttcagatggataaataccaaaattataat
ggcatttcaatgttaactgtcttgagcacagctactaagtatgtgaaagaggcgaaacca
gatgatgaaattatgcaatagaggattgagtaatgtagattaagtattcaactgatttta
tagaaacatcagtttgaattggatgaaattaattagaagattgaagacttgtatgctata
atgaaaaaatacaagtattttctgtaaagcattttaattcatgaaggggcagcagagtct
ggtcattattatacttatatttacaatccatcgttgaaacattggtttaaattcaatgat
atcaatgtcacttaggtgagtgaggagaaagtgttgcgtgatgcttatggagatggcaaa
tcaaaaactaatgcatactgtttaatctattaacgtgctgatcattttgaacctcaatct
tattcagattacacgaacaattctgtttatgctcagtacattcaatagaatctctatgaa
gaagtcaaaaatgataacaaaaagttttcaatcgaacaataagaacatgaacttgtagag
ttgggagatttggtagttgagatttataatgtataattccaataagtaaatgaaatggct
aggaaattcaaatatagaaatggtaatccactcaacaattttccaacctatttgcgcact
ctgttagatcagatgaatgatctagtgaagtggagcatcttggattatgccatcagagaa
gcatctcaaggcaaaagaaatttgagagattaccaagaataaatgatctttcaataaagg
tgtatatctattatattgatcctagaatcaaatacaattttgaataattga

DBGET integrated database retrieval system