KEGG   Paramecium tetraurelia: GSPATT00039649001Help
Entry
GSPATT00039649001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
ptm  Paramecium tetraurelia
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GSPATT00039649001
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    GSPATT00039649001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     GSPATT00039649001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 1225 aa AA seqDB search
MDRQLQTSQRIFTKAQVDEKVKYLLCVDMDSHQIFTINLKNHEICIEYEVPQVYRVKAKK
DIMDIQKLVQLPDSSWNMDTLRNQRYRRREISEYLLHKIVNQEPTYLAESSMSDAFSKVT
SLKLIVDLSDYIRLEDQAYQDINPITIELHVDLVTCSDEVIKKILRVVYNNFQVRLKTKS
PENQFVLQISGFREYLAGNYSILSYDRVRMNLRGIQYLQVNLTEVSKVRRMYDNFPPIFE
RNADESVPWEQFMDIPCFLFYAPFPLRDIQNEEGKKRKKISRQDSNFSPLRPRLFLKERC
LEFVEMRYQMLQERYFPLKKSIIYSGECDYRFKIQILCLSNVHRLFILDDKDLDEFKKQN
GHKRRATYNGQCPPRFITKASAKQEEQHNTSKKKVKVEDEEKLQKKISFLKLCKTKEQDA
AQIKQLSKGTFNPHFFNHGPQGTANMECLMQKYELDIQPYLISVQVLLMYGQTPLTKFSI
VNSQKVPFRQNTWFYQDVSFQGLKISQLPMELRLCFNIVLHSSNGEEQIIGSTITELFDE
NGKLKQGRLHLNVWPFYKCDTRIACMNEYYGAALPNQERTPYYTQLVIGMPTFIEDVYWS
LRDEKYMKQVGFPSTPLNIQQISLQYMNGILERRGTLNSSVTVRPQRDWKATPNTNELAK
LDRLLKFDPLQRHLYTDEDKFILLKCRNHYKNQPSAFPIFLCAINWSDPEEIREVYQMMK
VWTSLPSDDALPLLDANISDELVRYYATKRVGLYKDDELVLFMLELTQALIFEQCHFSPL
GEMLIERSIMNPWVVGHELFWQLRSQLHIQPTYERYSLILEQLMMLFGNYRYELFGEVQV
NDEIMQIADFIKTEKDSGKRLKEMKNKLQDARQKFSKTFQFAIDPRMSASELIYEKCKIL
DSKKLPLWLVMKSAETRDVTQIPKQIIMLSSKNLKDTDCLENLRREKELRKITINDKFLI
IFKCGDDIRQDLLTLQLIKIMDKIWLDFGLDYRMKPYKVISTLDQVGMIEVVLNSDTTSS
IHENAGKFGALNKSSIMEYLKKHNKHSMENAVENFLRSCAGYCVATYLLGIGDRHSGNIM
LTESGHLFHIDFGHFLGNKLTIILGNFKTKYGINRERTPFVFTQEMAYVMGGVQGHNFQR
FEDFCTKAYNQIRQHGHLLINIFLMNLSAGMPELQEIADIEYLREKLQLDIGEQQATELF
RKEITTSLNDMWRKIDNLIHNFTRD
NT seq 3678 nt NT seq  +upstreamnt  +downstreamnt
atggatagataattgtaaactagccaaagaatctttacaaaagcttaggttgatgagaag
gttaaatatttgctttgtgttgatatggattctcattaaatcttcactatcaatcttaag
aatcatgaaatctgcattgaatatgaggttccttaagtatacagagttaaggcaaagaag
gatattatggatatccaaaaattggtttaattacctgattcctcatggaacatggacact
ttgagaaactaaaggtatcgaaggagagaaatctcagaatatttattgcataagatcgtg
aactaggagccgacctatttggctgaatcatcgatgtctgatgcattctccaaagtcact
tcactcaaattgattgtagatctaagcgattacatcagattggaagactaagcatattaa
gatataaatcctataacaattgaactgcatgtggatttagtcacttgttcagacgaggtg
atcaagaagatcctgagagtagtctacaacaacttttaagtaagactgaaaactaaatcc
cctgagaattaatttgttctgtagatttctggttttagagaatacttagcaggaaactac
tcaatattgagttacgatagagtcagaatgaatttaagaggtatataatatttgcaagtt
aatctaaccgaagtttcaaaggttcggaggatgtatgataattttcctcccatttttgaa
agaaatgcagatgaaagtgtaccttgggagtaatttatggacatcccttgttttctgttt
tatgctccatttcccttgcgagatatacagaacgaggaggggaaaaaaagaaaaaagata
agtcgacaagactcgaatttctcacccttacgacctcgtttatttcttaaggagagatgc
ttggaattcgttgagatgaggtactaaatgctgtaagaacgttacttccctttaaaaaag
agcatcatctactctggagaatgtgattacagattcaaaatttaaattctgtgtctctca
aatgtgcatagactcttcatactggatgataaagatcttgacgagttcaaaaaataaaat
gggcacaaaagaagagcaacttataacggtcaatgtccacccagatttattactaaagca
tcagcaaagcaagaggaataacataatacttctaaaaaaaaagtgaaggtggaagatgaa
gagaaattgcagaagaagattagtttcctaaagttgtgcaagactaaggaataggatgct
gcataaattaaataactttctaaagggacttttaatccacatttttttaatcatggtcca
taagggacagccaatatggaatgtctaatgtagaagtatgaactcgatatacaaccgtat
ttgatatctgtttaagtgctattgatgtatggccagactcctttgaccaaattcagtata
gtcaacagtcaaaaagtaccattcaggcaaaacacctggttttatcaagacgtttcgttt
taaggattgaaaatctcttagttacctatggaattgagattgtgtttcaacatagttttg
cattcctcaaatggggaagaacaaataattggtagtacaatcacagaactatttgatgaa
aatggaaaactaaagtagggcagactgcatctaaatgtgtggccattctataaatgtgat
actaggatagcatgcatgaatgaatattatggagcagccttgccaaatcaagagagaaca
ccttattacacttaattggttattgggatgcccacattcattgaagatgtttattggagt
ttgagagatgagaaatacatgaaataagttgggttcccctccactccattgaatatctaa
cagatttctctctaatatatgaatggaattttagaaaggagaggaaccttgaattccagt
gtcacagtgcgaccttaaagagattggaaagccactccaaacacaaatgaattggctaaa
ttggatcgattgttaaaatttgatcctctttagcgtcatctttacacagatgaagacaag
ttcattctgctgaaatgtagaaatcactacaagaattagccatctgcatttccaatcttt
ttgtgcgctatcaattggagtgatcctgaggagattagagaagtatatcagatgatgaaa
gtttggacgagtctaccttctgatgatgccttgcctctcttggatgcaaacatttcggat
gagctagttaggtattatgctacaaagagagtaggtctatataaggatgatgaattggtg
ctttttatgctggaattgactcaagctctcatttttgaatagtgtcatttttcacctttg
ggagaaatgcttattgaaagatccatcatgaatccttgggttgtgggacatgaattgttt
tggtaattgagatcataattgcacattcaaccaacttacgagagatatagtttaattttg
gaatagcttatgatgctttttggaaattacagatatgagttgtttggtgaggtttaagtc
aatgatgagatcatgtagattgctgattttatcaagacagagaaggattcaggcaaaagg
ttaaaagagatgaaaaataaactgtaagatgccagacagaaattctctaaaacctttcaa
tttgcaattgacccaagaatgagtgcttcagaattgatttacgaaaaatgtaaaatatta
gatagcaaaaaactacctttatggttagttatgaaatctgctgaaactagggatgtgact
caaattccaaagtaaatcatcatgttatcttctaagaatttgaaggatactgattgtctt
gagaatctaagaagagagaaggaactaaggaaaatcacaataaatgacaagttccttatt
atttttaaatgtggagatgacatcagacaagatttgctgaccttgcaattgataaaaatc
atggataaaatatggttagattttggtcttgattatcgtatgaagccatacaaagtgatc
tccacattggattaagtaggaatgattgaagtagttctcaattcagacactacttcaagt
atccatgagaatgctggcaaatttggagctttgaacaaaagttccattatggaatatctg
aaaaaacataataaacacagcatggaaaatgcagttgagaatttcttaagatcttgtgct
ggctactgtgttgccacgtatcttcttggaattggagatagacacagtgggaacatcatg
ttaactgaaagtgggcatctatttcatatagattttggtcattttttgggtaataaactc
accattattttaggtaatttcaaaactaaatatggaatcaatcgagaacgaactcctttt
gtcttcactcaagagatggcatatgtaatggggggagtgtaaggacacaatttccaaagg
tttgaggatttctgcactaaagcctataatcaaattcgatagcatgggcatttgctaatc
aatatcttccttatgaatttgtcagcaggcatgcctgagctccaagagattgcagatatc
gaatacttaagggagaaattgcaattggacattggtgaacaacaggctactgaattgttc
aggaaggaaattactactagtttgaacgacatgtggagaaagattgacaatttgattcac
aactttacaagagactga

  All links  
No link information was found.   
DBGET integrated database retrieval system