KEGG   Paramecium tetraurelia: PTMB.385cHelp
Entry
PTMB.385c         CDS       T01055                                 

Definition
Ubiquitin-specific protease
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MGVTQSSQNDHLEKYLGQDFPDGEILIGFENPSNICYSNVILQALYYCKDFRNYILQHQN
SINQNNLLDLTKLLFQSISNHKQRTGVISTKKMMNYIKTKNKIFDGKYHQDSHEFYMWFI
NECDELLKDKQNNWIRQIFQGQQLTQTECLNCHTISQREEMYCDLSLDLFPNYSLNTCLQ
QMSKEEQLNGQNQFFCDKCQSKQDASKRLLLNTLPNVLVIHLKRFKYDERCGQMIKVSTK
IPFSQQLRIKAQKQTKTYELTTIIIHLGQGILYGHYICITKIQGKWFKFDDDKISLFVDQ
DLHYVYGRSYPTQAQTCAYMLFYNAQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaacataatctagttaaaatgatcatttagaaaagtatttgggttaagacttt
ccagatggggaaatattaattggattcgaaaatccaagtaacatttgttactcaaatgta
atattgtaggcattgtattattgcaaagactttaggaattacattttatagcattaaaac
tcaataaatcagaataatttgttagatttaacgaagttgttgttccaatcaatatcaaat
cataaatagaggactggagtaatttcaacaaagaaaatgatgaattacatcaaaacaaaa
aataaaatatttgatggaaaatatcattaagattcccatgaattttatatgtggtttatc
aatgaatgcgatgaattattaaaggataaacaaaataattggattcgataaatattttag
ggatagtaattaacataaacagaatgtttaaattgccatacaatctcttaaagagaagaa
atgtattgtgatttgtctttagacttatttccaaattatagtttgaacacatgtttgtaa
taaatgtcaaaagaggaataattaaatggacagaatcaatttttttgtgataaatgccaa
tcaaaataggatgcatctaaaagattgttgttgaatactttacctaatgttttagtaatc
catttgaaaagatttaaatatgatgaaagatgcggtcagatgattaaagtgtcaacaaag
attccattttcataataattaagaataaaggctcagaagtagactaagacttacgaattg
actacaattattattcatttgggtcaaggcatattgtacggacattatatttgcataaca
aaaatataaggaaagtggtttaaatttgatgatgataaaatatctttatttgttgattaa
gatctacattatgtttatggaagaagttatccaacacaagctcaaacatgtgcatatatg
ttgttttataatgcataatga

DBGET integrated database retrieval system