KEGG   Paramecium tetraurelia: PTMB.420Help
Entry
PTMB.420          CDS       T01055                                 

Definition
Histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PTMB.420
Transfer RNA biogenesis [BR:ptm03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    PTMB.420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 551 aa AA seqDB search
MEQKEKKGKKQQDSTVDKLKCISEIVAELIKQYDSNQKINLSQIKAEFSKKNKISGAPKI
VEILSAIPDDYKDKLIPILKAKPVRTASGIAVVAVMAKPHRCPHIAVTGNICIYCPGGPD
SDFEYSTQSYTGYEPTSMRAIRARYNPYIQARDRIAQLKQLGHDCDKVEYIIMGGTFMSL
DQEYRDYFIRNLHDALSGHRSQTVKESVQFSEESRSKCIGITIETRPDFCQKSHLSDMLL
YGCTRIEVGVQSIYEDIARDTNRGHTVESVKKCFAMSKDSGYKVVTHMMPDLPNMGVERD
LESFKEFFENPDFRPDGLKIYPTLVIRGTGLYELWKNGQYRNYPPDFLVDVVAKILALVP
PWTRVYRIQRDIPMPLVTSGVDNGNLRELSLQRMRDLNVACRDVRTREVGIKEVHHKIKP
EQVELIRRDYTANDGWETFLSYEDPSQDILIGLLRLRRLDKHTFRKELTQEPTSMVRELH
VYGSVVPIHSRDPSKFQHQGYGTLLMEEAEKIAREEHGSTKMAVIAGIGTRHYYRKLGYH
SEGVYMVKKLV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggagtagaaagagaagaagggaaaaaaataataagattccacagtggacaaattgaaa
tgcatttcagaaatagttgccgaattgattaaatagtatgatagcaattagaaaattaat
ttatcacaaataaaagcagagttttcaaaaaagaataagatctcaggagcacctaagata
gttgaaatcttatcagccattccagatgactataaggataaattgataccaattttgaag
gcaaaaccagtgagaacagcatctggtatagcagtggttgctgttatggccaaacctcat
agatgtccacatatagctgttacaggaaacatttgcatttattgtccaggaggacctgac
agtgattttgaatattctacttaaagttatacaggatatgaacctacaagtatgagagca
attagagcaagatataatccatatattcaagcaagagatagaatagcttaattaaaataa
ttgggtcatgattgtgacaaggtggaatacattataatgggtggaacattcatgtccttg
gattaagaatacagagattattttattagaaatttgcatgatgcattaagtggccatcgt
tcataaacagtcaaagaatcagtccaattctctgaggagagtagatctaagtgtataggt
ataaccatagaaacacgacctgatttttgttagaaaagtcatttgagtgatatgttatta
tatggatgtactcgtattgaagttggtgttcaatcaatttatgaagatattgcaagagat
actaatagaggacatacagttgaatctgtaaagaaatgttttgcaatgagtaaagatagt
ggatacaaagtggttacacatatgatgcctgatttacctaatatgggagtagaaagagat
ttagagagttttaaagagttctttgaaaatcctgatttcagacctgatggattaaaaatt
tatccaactcttgttattagaggtactggattgtatgaattatggaaaaatggataatac
agaaactatcctcctgatttcttagttgatgttgtcgctaaaatattggcattggtacca
ccttggactagagtctatagaatatagagagatattccgatgcctttagtgacatcagga
gtagacaatggcaatttaagagagttatcattacaaaggatgagagacttaaatgttgcc
tgtagagatgttagaacaagggaagttggaatcaaagaagttcatcacaaaattaaacca
gaataggttgaattaattagaagagactatactgctaatgatggatgggaaacattctta
tcttacgaagatccttcttaagatattttaatagggttgttgagactcagaagattggat
aaacacactttcagaaaagaattaactcaggaaccaacttccatggttagagaattgcat
gtctatggttcagtggtccctattcattcaagagatccttctaaattctaacatcaagga
tatggtacattgcttatggaagaagcagagaaaattgcaagagaagaacatggaagtact
aaaatggcagtcattgctggaatcggaactagacattattatcgtaaattaggatatcat
tctgaaggagtctatatggtaaaaaaattagtatga

DBGET integrated database retrieval system