KEGG   Pseudoalteromonas translucida: PTRA_a1043Help
Entry
PTRA_a1043        CDS       T04220                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ptn  Pseudoalteromonas translucida
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ptn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PTRA_a1043 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    PTRA_a1043 (atoB)
   00640 Propanoate metabolism
    PTRA_a1043 (atoB)
   00650 Butanoate metabolism
    PTRA_a1043 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    PTRA_a1043 (atoB)
   00072 Synthesis and degradation of ketone bodies
    PTRA_a1043 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PTRA_a1043 (atoB)
   00310 Lysine degradation
    PTRA_a1043 (atoB)
   00380 Tryptophan metabolism
    PTRA_a1043 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PTRA_a1043 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PTRA_a1043 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PTRA_a1043 (atoB)
Enzymes [BR:ptn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PTRA_a1043 (atoB)
Exosome [BR:ptn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTRA_a1043 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:981853..983004
Genome map
AA seq 383 aa AA seqDB search
MTHAYIVDALRTPTGRRKGGLAHVHAIDLGAAVLKPLVERNNIPAEDYDDVIFGCVDTIG
SQAGNIARTSWLAAGLAMNVPGTTVDRQCGSSQQAVHFAAQAIMSGTQDVIAVGGVQTMT
QIPISSAMLAGQPLGFSTPFAESKLWDARFGDAPVNQFYAAQRIADHWGISRADMEVFAL
ESHRRALAAAAEGRFDREIVAIEGLTADETPRESSLAKMAELEPVDPTYPSITAAVSSSV
CDASAAMLIVSERALKKYNLTPRARIHHVSVLGDDPIWHLRAPIPATIAALKKANLTLDD
IDLVEINEAFASVVMAWLKETGYSHEKTNVNGGAIALGHPLGATGVRLMTGLLHELERTG
GRYGLQTMCEGGGLANVTIIERL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgcatatattgtagatgcactgcgtacacctacaggcagacgcaaaggcggc
cttgcccatgtacatgccatagacttaggtgcagcagtattaaaacctttggttgagcgc
aataacatacccgcagaagattacgatgatgtaatttttggctgtgtagacacgataggc
tcgcaagcaggaaacattgcccgcaccagttggttagcggcagggttggccatgaatgta
ccgggtactacggttgatagacaatgtggctcatcgcaacaagccgtgcattttgctgcg
caagcgattatgagcggcacgcaagatgtgatagcggtaggcggcgtgcaaacgatgacg
caaattcctatttcgtcagccatgttagccgggcaaccacttggctttagtacgccgttt
gcagagagtaaattgtgggatgcacgctttggcgatgcgccggtaaatcagttttatgcc
gctcagcgcattgccgatcattggggtataagccgcgccgatatggaagtgtttgcccta
gaaagtcaccgccgtgcattagcggcagcagcagaggggcgctttgatcgagaaatagtg
gcgattgaaggattaacagctgatgaaacacctagagaaagtagtttggctaaaatggct
gaacttgagccggttgaccctacttacccaagtattacagctgcggtttcgagctcagtg
tgcgatgcatcagcagcaatgcttattgtgtctgagcgcgcattaaaaaaatataacctt
accccaagagcgcgtattcatcatgttagcgtactgggagatgaccctatttggcatctt
agagcgcccattccagctactatcgcggcattaaaaaaagcgaatcttacgcttgatgat
attgatttagtggaaattaatgaagcgtttgcctctgtagtaatggcatggttaaaagaa
accggttacagccatgaaaaaactaatgttaatggtggtgctattgcacttggccatccg
cttggtgctacgggcgtgcgtttaatgaccgggttattacatgaattagagcgtacaggc
gggcgttatggcctacaaacaatgtgcgaaggcggcggtttagctaatgtcactatcatt
gaacgattataa

DBGET integrated database retrieval system