KEGG   Picrophilus torridus: PTO0020Help
Entry
PTO0020           CDS       T00177                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pto  Picrophilus torridus
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PTO0020
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PTO0020
Enzymes [BR:pto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PTO0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22078..23442
Genome map
AA seq 454 aa AA seqDB search
MNYGYFIETGIPGDDIENIKKFLSKLRPMHIILMRGNFSNKRELASLISKINKFYINDLK
LNRPVFSIDQEGGNVIRISDIDYLPSNYCLGFINKADISRMAGLITGSELRSIGILWNHA
PVLDLLESPKNPVILERSFGKNSKKVSKLGKSYINGLQSAGVAATAKHFPGHGSVIEDSH
LTMPVDNRNINEIKTSMMPFVSAINSGVKSIMLSHVLYSSIDDVPASLSKRINDILRRDL
NFTGVSVTDSIDMKALSSNFSIREIAMRSNADIIESVDPETSIELMDFIKVKDINRDSYK
RIINLVPDDYIKMPDKGMSFISYMCVKKFRGKYLSRDIETDIIFMPNISRTLVETGRIDY
KNVISMLKKRIKRINIFDYENYNGSARQVIIIGRNLHIKNYELKDLTFKKRSFYISTGIN
CDINNVPGGTGYISCFSTKPESVYLAILRAFGLI
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaattatggttattttattgagaccggaattcccggagatgatatcgagaacataaaa
aaatttctttcaaaattaaggccaatgcacataatattaatgaggggaaatttctcgaat
aaacgggaacttgccagtttaatatcaaagataaataaattttatattaacgatcttaag
ttaaacaggccggtgttttcaatagaccaggagggcggcaacgtcataaggatcagtgat
attgattatcttccaagcaattactgccttggatttataaataaggcagatatttcaaga
atggcaggccttattacaggctcggagcttagatccattggaatactctggaaccatgcg
cctgtactggatcttctggaatcaccaaaaaatcctgtgatacttgaaaggtcatttggt
aagaattcaaaaaaggtatcaaaactcgggaaatcgtatataaatggactgcaatctgca
ggtgttgcggccactgcaaagcatttccccgggcacggcagcgttattgaggattcgcat
ttaacaatgcctgttgataacagaaatatcaatgaaataaaaacctccatgatgcccttt
gtatccgcaattaattccggggttaaatcaataatgctatcacatgttctttattcatcc
attgatgatgtgcccgcatcattatcaaaaaggatcaatgatatattaagaagggatcta
aatttcacgggagtttccgttaccgactcaattgatatgaaggcattgtcatcgaatttt
tcaataagggaaatagcaatgagatcaaatgcagatataatagaaagcgttgaccctgaa
acgtcaattgagctcatggattttataaaggttaaggatattaatcgcgattcatataaa
agaataataaatcttgttccggatgattacataaaaatgcctgataagggcatgtcattt
atatcatatatgtgcgtgaaaaaatttaggggaaaatacctaagcagggacattgaaacg
gacataatatttatgccgaatatatcaagaacccttgttgaaaccggaaggatagattat
aaaaatgtaatttcaatgcttaaaaaaagaataaaaaggatcaatatctttgattatgaa
aactacaatggcagtgccaggcaggttataatcataggaaggaatctgcatataaaaaat
tatgaattaaaagatttaacatttaaaaaaagatctttttatatatcaacagggataaac
tgcgatattaataatgtgccagggggaacaggatacatatcatgcttcagcacaaagccc
gagagcgtttaccttgcaatactaagagcctttggacttatttaa

DBGET integrated database retrieval system