KEGG   Picrophilus torridus: PTO0067Help
Entry
PTO0067           CDS       T00177                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pto  Picrophilus torridus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pto00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
72934..75051
Genome map
AA seq 705 aa AA seqDB search
MIKLYNTCMDFKCLNDVECSHPEKILGPHLEDAYIIRAYIPIARAAFILIDNKKYQMIDN
GKVFEYRSDNEINDYKILYIDDSGYEKTIDDPYRFRPEISDYDIYLYGTGRLFEAYKTFG
AHLKTIKDVSGCNFVVWAPSALSVSVVGNFNHWTPGMHPMINVNDSGIWALFIPGIKENE
VYKFAIKTKNNEIKMKTDPFAFYTEKRPRTGSIVINDDFHWTDNSFKRSENALSIYEMHL
GSWKRNNGDYYNYREIADMLIDHLKKTGFNCVEIMPVMEHPLDISWGYQVVNYFAPTSRY
GKPDDFKYLVNRLHENNIMVILDFVPAHFPDDDYGLYMFDGTHLYDYEDPRMGRTPDWGT
NIFDFGRNGVRSFIASAAVFWIDKYHVDGLRFDAVTSMIYLDFGRKPGEWIPNINGGNIN
LEAVSLLKEINDYIHNKYYNVITVAEESSTYPGITSESGLNFNYKWNLGWMHDTLDFFHE
DPLYRKYRINNLTFSVMYMYSENFILPVSHDEVVYGKGSLYRKMPGNKNEKISNVKLFLS
YMFSYPGKKLLFMGNEFAQKNEWNVLSQLSWNDLDDGKYVMELIHDLNNLYKNDFNFYND
KNFSWIDFNDKTNTVISFNRGNAVCIFNFTPVERENYAIGVDYPSRYIEIINTDSKKYNG
GNILNESIYACKYPMHGRRYSIEIDLPPLAAVIMEPEDLNGSSGN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgataaaattatataatacatgcatggattttaaatgcttaaatgatgttgaatgcagc
catccagaaaaaatattaggtccacatcttgaggatgcttacataataagggcgtacata
ccaattgccagggccgcattcatattgatagataacaaaaaatatcaaatgattgataat
ggcaaggtttttgaatatagatcagacaatgaaataaatgattataaaatattatacatt
gatgattcaggctatgaaaaaacgatcgatgacccttacaggttcaggcctgagatctcc
gattatgatatatatttatacggaacaggaagattatttgaggcatacaaaacatttggt
gctcatttaaaaaccataaaagatgtttcaggctgcaactttgttgtgtgggctccatca
gcattatcagtttcagtcgttggaaatttcaatcactggacaccgggcatgcatccaatg
ataaatgtaaatgattccggcatctgggcgctttttatacctggtataaaagaaaacgag
gtttataaatttgcaataaaaacaaaaaacaatgaaataaagatgaagacggatccattt
gcattttacacagagaaaagaccaagaacaggatcaattgtaataaatgatgattttcac
tggacagataattcattcaaaagatccgaaaatgcgttgtcaatatacgaaatgcatctt
ggctcatggaagagaaataacggtgattattacaattacagggaaatagcagatatgctt
atagatcatttaaaaaaaacagggtttaactgcgtcgagatcatgccagtaatggagcat
ccacttgatatttcatggggataccaggttgtaaactactttgcaccaacatcaaggtac
ggaaaaccagatgattttaaataccttgtaaacaggctccatgagaataacattatggtc
atactcgactttgtgccggcgcattttccagatgatgactacggcctttacatgtttgac
ggaacacatttatacgattatgaggacccaagaatgggaagaacccctgactggggaaca
aacatctttgatttcggcaggaacggcgtcaggtcttttattgcatctgcggccgttttc
tggattgataaataccatgtggacggattaagattcgatgccgtgacatcaatgatatac
ctggactttggcagaaagccaggcgagtggattccaaatataaacggcggaaacataaac
ctcgaggcggtttcgcttttaaaggagataaatgattacatacataataaatattataat
gtaataactgtggcggaggaatcaagcacataccctggaataacatcagaatcagggtta
aattttaactacaaatggaatcttggctggatgcatgacacactcgatttcttccatgag
gatccattgtacagaaaatacagaataaataatttaacattcagtgttatgtacatgtac
agcgagaattttatactgccagtatcccatgatgaggttgtctacggcaagggctcactt
tacagaaagatgccaggaaataaaaatgaaaagatttccaatgtaaaactgtttttatca
tacatgttttcatatccagggaagaagcttctttttatgggcaacgaatttgcacagaaa
aatgaatggaatgtgctttcacagctttcatggaacgatcttgatgatggaaaatatgta
atggaattaatacacgatttaaacaatttatacaaaaacgattttaatttttacaatgat
aaaaatttttcatggatagatttcaatgataaaacaaacactgttataagttttaacagg
ggcaatgccgtatgtattttcaattttactcctgttgagcgtgaaaactatgcaataggc
gttgattatccatcgaggtatattgaaattataaacaccgattcaaaaaaatacaatgga
ggcaacattttaaacgaatccatttatgcatgtaagtacccaatgcacgggagaagatac
tcgatagaaatagatctgccgccactggcggcagttattatggagccggaggatttaaat
ggatccagtggcaattga

DBGET integrated database retrieval system